KEGG   Cryptococcus neoformans var. neoformans JEC21: CNG01460
Entry
CNG01460          CDS       T00243                                 

Definition
(RefSeq) hypothetical protein
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
SSDB
Other DBs
NCBI-GeneID: 3258591
NCBI-ProteinID: XP_024513197
LinkDB
Position
7:complement(join(420949..422115,422170..422307,422367..422909))
AA seq 615 aa
MPAYVPPHLRNRSTPSTLSTPATPVQSTTSSNNGDRSTPLTYSNGNANRTPSSNTRWSSN
GSGVGHGSGIGHKNGSPWESGHPGKSHFSRRSYQSSPSSSYPQPNSAYNTPTNSRRDNYT
QSGNNGKWTDKNDSPQPRHGRAYIQHSPAQLHVFGDSFVGPFKLMDGDSVQIKTFKGASA
KGLNNPKSIKQVSKELLPILNSLMVPPPYAYQSSSSAKRSVMLVFGNVDLQINYIWQLAN
KPITSLSSPSSSSDPSDSSTNDSDHPDSTNILHSATETSSTGPALGPEDFVNAVVRAYTT
FLEREVVHGPVGERLSSIAEKKRSSGVGQSTAVNGKDVGGPPKVFIAAALPPLIEDEMLP
RIPEKYVERLEEDFEKQQRMVGRGWKPHQGVGAGMSARADVGGGKDEGDLVDGLSLLRVS
DKPVCRPEVSPGPSTTASSSIPSPALDTPLTEPTASPTAFSADNGNSNGNGSSKTKTPIA
SLLTHSPPLCTLPVRVRMTDQFNNLLSSFCAQYPDIFTFIDISPAMHLGSEAPSIHGEVD
RGVWACPVDRTNVHPVWEPTLPLWLEALKREGMDTDTWKMCDDAEETFKAYEIDKRRRTA
AAGYGGEISMKLRDE
NT seq 1848 nt   +upstreamnt  +downstreamnt
atgccggcttatgttccaccacacttgcgcaatcgctcaacaccctctaccctgtcaact
cccgcgaccccggtccaatcgacgacttccagcaacaacggcgataggtcgaccccactc
acgtactcgaacggcaatgccaatcgtacaccgtccagcaacactaggtggtccagcaac
ggaagtggagtagggcacggaagtggtattggtcacaaaaatggatcaccatgggaaagt
ggccatccagggaaatcacacttttctcgtcgatcataccaatcaagtccgagctcgagc
tatccccaacccaattctgcatataatactcccactaacagcagacgcgataactataca
cagagtgggaataacgggaagtggacagacaagaacgatagtccccaaccgaggcatgga
cgggcgtatatccagcattctccggctcagttgcatgtctttggggatagttttgttggg
ccattcaagttgatggacggggattcggtgcaaatcaagacattcaagggagcttctgcc
aagggattgaataacccgaagtctatcaagcaagtgtcaaaagagcttttaccaattttg
aacagtttgatggtccctccaccgtacgcatatcaatccagctctagtgctaaacggtct
gtcatgctagtgtttggcaacgttgatctgcaaattaattacatctggcagctcgccaac
aaaccaatcacctcactctcatctccttcttcctcttccgacccttccgactcgtccaca
aacgactctgatcatccagattcaaccaatattctccattctgctaccgaaacgtcctct
actggacccgctctcggtcccgaagactttgtcaatgctgtcgtgagagcgtacaccact
tttctcgagcgagaagtcgtacatggacctgtgggcgagaggctctcgtccattgcggaa
aagaaaagaagttcaggagttgggcagtctaccgccgtcaacggcaaggatgtgggcgga
cctccgaaagtcttcatcgccgctgcccttccgcctctcattgaggatgagatgctcccc
cgtatcccggagaagtatgtggaaaggcttgaagaggactttgaaaagcagcagcgtatg
gttgggcgtggctggaagcctcatcagggtgttggtgcaggtatgagtgcccgtgccgat
gtgggtgggggtaaagatgaaggggatttggtggatggtttgtcattactgcgagtaagc
gataaacccgtctgtcgacctgaagttagtcccggtccgtctacgaccgcatcgtcaagc
attccttcacccgctctagatacacccttgactgaacctactgcttcgcccaccgctttt
tctgccgataatggtaacagcaacggtaatggctcaagcaaaacgaagacgcccatcgcc
tctttactcacccattccccgcctttgtgtaccctccctgtcagagtccgtatgaccgac
caattcaacaatctcctctcttccttttgcgcgcagtatcctgatatattcacttttatc
gacatttctcccgctatgcatctaggatccgaggcgccttctatccatggagaagttgat
aggggtgtatgggcctgtcctgtggaccggactaatgtccatcctgtgtgggagccaact
ctgccgctttggttggaagcactaaaaagggaaggaatggatacggatacgtggaaaatg
tgtgatgatgcggaagagacattcaaggcatatgagattgataaacggagaagaacggcg
gcagcgggatacgggggtgagatatctatgaaattgagggatgagtag

DBGET integrated database retrieval system