KEGG   Cryptococcus neoformans var. neoformans JEC21: CNG03480Help
Entry
CNG03480          CDS       T00243                                 

Definition
(RefSeq) succinate dehydrogenase iron-sulfur subunit, putative
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00020  Citrate cycle (TCA cycle)
cne00190  Oxidative phosphorylation
cne01100  Metabolic pathways
cne01110  Biosynthesis of secondary metabolites
cne01130  Biosynthesis of antibiotics
cne01200  Carbon metabolism
Module
cne_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cne_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cne_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CNG03480
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CNG03480
Enzymes [BR:cne01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CNG03480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer2
Motif
Other DBs
NCBI-GeneID: 3258643
NCBI-ProteinID: XP_572035
UniProt: Q5KDM1
LinkDB All DBs
Position
7:join(975057..975221,975323..975409,975492..975660,975716..975758,975814..975961,976017..976032,976091..976149,976229..976303,976353..976433)
Genome map
AA seq 280 aa AA seqDB search
MVRPATVLRSLNAIPSTSRPLAAAARSFHATASAQLATPVEGKQPPIKEFKIYRWNPDVP
NEKPKLQTYKIDLSQCGPMMLDALIKIKNELDPTLTFRRSCREGICGSCAMNIDGVNTLA
CLCRIPKDTSKDSKIYPLPHMYVVKDLVPDLTHFYKQYKAIEPYLKNDNPPEKGEFLQSQ
ADRKKLDGMYECILCACCSASCPSYWWNQDEYLGPAVLMQAYRWMADSRDSYGAERKEKM
QNAMSLYRCHTIFNCSRTCPKGLNPAAAIAKMKLEMATGE
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggtccgcccagccaccgtcctccgttctctgaacgctatcccttccacctccagaccg
ctcgccgctgccgccaggtctttccacgctaccgcttctgcccagctcgccactcctgtt
gagggaaagcagcctccaattaaggagttcaagatctaccgatggaaccccgatgtcccc
aatgagaagcccaagctccaaacatacaagatcgatctctcccaatgcggccctatgatg
ctcgatgctttgatcaagatcaagaatgagctcgaccccactcttactttccgacgatct
tgccgagagggtatctgtggttcctgtgccatgaacattgacggtgtcaacactcttgct
tgcttgtgccgaattccaaaagacacctccaaggattccaagatttacccccttcctcac
atgtacgtggtcaaggacctcgtccccgaccttacacacttctacaagcaatataaggct
atcgaaccttacctcaagaacgacaaccccccagaaaagggagagttccttcaaagtcag
gcggacaggaagaagttggacggaatgtacgagtgtattttgtgtgcttgttgctcagcc
tcttgcccttcatactggtggaatcaagacgaataccttggtcccgcagtgttaatgcag
gcttaccgatggatggctgactctcgagattcttacggcgccgagcgaaaggagaagatg
cagaacgccatgtctctttaccgatgccacaccatcttcaactgctctcgaacatgtccc
aagggtcttaaccctgccgccgcgattgccaagatgaagctcgagatggctaccggagag
taa

DBGET integrated database retrieval system