KEGG   Cryptococcus neoformans var. neoformans JEC21: CNH01310Help
Entry
CNH01310          CDS       T00243                                 

Definition
(RefSeq) alpha-glucosidase precursor, putative
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00052  Galactose metabolism
cne00500  Starch and sucrose metabolism
cne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CNH01310
   00500 Starch and sucrose metabolism
    CNH01310
Enzymes [BR:cne01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     CNH01310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 3259089
NCBI-ProteinID: XP_024513329
LinkDB All DBs
Position
8:join(801126..801291,801346..801842,801897..801955,802010..802038,802089..802170,802219..802292,802346..802526,802587..802606,802742..802750,802798..802886,802944..802994,803059..803161,803217..803305,803365..803443,803497..803573,803624..803941,803997..804040,804099..804153,804206..804318,804380..804508,804561..804958,805017..805270)
Genome map
AA seq 971 aa AA seqDB search
MTLLFQFLTLLLPILAGAIPAYRPATLESFQLRDQSSWAVASQQPDFSGDVTQCKGYAIN
SDSVRQTSTGGISAQLDLITYCSAYGTDIPSLTLSVEYETSSRLHVHIYDTPVKQFQIDD
NILPRPKRTLFGTDSADKSDLKFDYENSPFAFWVTRKSDGEILFDTRKDGIPIHEDPSDI
LGSPSNYTVMPAHPLVFEDQYLQLSSKLPVGANIYGLGEAVSGSGYRRNSSSTVQTMWAR
DIADPVDENLYGTHPFYMEVRYNETSCTLASHGVFLRNSNGMDVVLRDGAIQYRVIGGTL
DLYFVSGPSPNDVTEQYVSTVGLPQSMPEWSFGFHLCRWGYTSANDTLSVVNRMRDAGIP
LETQWNDIDWMRSYREFQFDQNYGEVDYRNLVETLHSRNQHYIPIFDAAIGHPLNATDRF
DVYDKGHELGVWMRNPDGTEYVGAVWPTFAVFPDWFHPKMQEVWTEAFYNYSQIVDFDGI
WLDMNEPSSFVDGSASNSTMSLENTTVIPPDYSTVAFPTDWPEGYSNVTGISGNVTVDGA
LTYGADGDAAKNTALRRSLIGRDDVLTIPYVDVPPYPINNGYGRLSAKTVSPNATHYGGL
QEYSVHNLWGSMEEDATNNMFLALKPGKRPFMVSRSTFAGSGRKTAHWLGDNFSTFAYMK
RSIQGVLQFNLFGIPMVGPDVCGFNGNTDEELCNRWMQLGAFFPFFRNHNIKSAISQEPY
VWDSVRDASIKAINARYQMLPYWSTLFAKSSLAGTPAVIPLFHEFPSPSYLDNDYQFLIG
PSVLVTPVLQPNESTVVGQFPTMNDVFWVDWWTHCKLDTSSGEDVTLDLPLGNIGVHVRS
GSALLLYDEPGYTVKETKDNGYAILVVLDGKGYAEGDAKIDDGESLPVTEQTCLTFKSTD
SCKLSSTAVGSYTIAGKLKTITIVGVWTEPSEVTLNGSKVQDSQVEYDKSLGRIKITGLV
QDLNSAWELMW
NT seq 2916 nt NT seq  +upstreamnt  +downstreamnt
atgactcttttattccagtttctcaccttgcttctccccatactggcaggagccattcct
gcatacaggcctgccaccctcgagtctttccaactacgagatcaaagcagctgggccgtt
gccagtcagcaacctgacttctctggtgatgtcacacagtgcaagggctacgccattaat
tctgattcagtcaggcaaacatccacaggtggaatctctgctcagctcgacttaattacc
tactgttccgcgtatggcacagacattccatctcttaccctttccgttgagtacgagact
tcatcgcgactacatgtccacatctatgacactcctgtcaagcaattccagattgatgac
aacatcttacctcgcccgaaacgaaccctctttgggacagatagtgctgacaaatcggat
ctcaagttcgactacgagaacagtccttttgctttctgggtcactcggaagtcagatggc
gagatcttattcgataccagaaaggatggtatccccattcatgaagacccttcagacatc
ttggggtctcctagcaactacacagttatgcctgctcatccgctcgtctttgaggatcaa
tacctgcagttgagctccaaattgcctgtcggagcgaacatctacggcttgggcgaagct
gtttccgggagtggctaccgcagaaactcgagctccaccgtgcagacaatgtgggcaaga
gatatcgctgaccctgtcgatgaaaacctttacggtactcatcccttctacatggaggta
aggtataacgaaacctcctgcactcttgcttcacatggcgtattcctgcgaaactcgaat
ggtatggacgttgtcctccgagatggtgctattcaataccgagtcattggtggtacactc
gatctctacttcgtttccggtccaagccccaacgatgtaaccgaacaatacgtatccacc
gtcggccttccgcaatccatgcctgaatggtcctttggattccatctttgtcgatggggt
tatacttccgccaacgacactctctcagttgtcaataggatgagagacgctgggattcct
ttggagacacaatggaatgacatcgactggatgaggagctacagagaattccaatttgac
cagaactatggagaggtcgattaccgaaacctagtggagactcttcactctcgcaaccag
cactacattcccatattcgacgcggctatcggtcatccgctcaatgctacggataggttc
gatgtatatgacaagggtcacgaacttggagtttggatgagaaaccctgatggtactgag
tacgtcggtgccgtctggccaactttcgccgtcttcccagactggttccaccccaagatg
caggaggtttggacagaggccttctacaattactcccagattgtcgattttgacggtatc
tggcttgatatgaatgaaccgtcatctttcgtcgacggttctgccagcaactctacaatg
tctttggagaatactacagtcattcctcccgattattctaccgtcgcattccctactgac
tggcctgagggttattcaaatgtgactggcatcagcggtaacgtcactgtagatggcgcc
ctcacttacggtgcagatggcgacgccgctaagaacaccgctcttcgtcgttccctcatc
ggtcgagacgatgttctcaccattccttacgttgacgtccctccctaccctatcaacaac
ggttacgggagattatccgccaagacagtcagccctaacgctacccattatggaggtctt
caagaatacagtgttcataatctttggggttccatggaagaggatgctacgaacaacatg
ttcttagccttaaagcctgggaagaggccattcatggtttctcgatctacgtttgccggc
agtggtcgaaagaccgctcattggctcggtgacaacttctccacttttgcctatatgaag
aggtctatccaaggcgtcttacagttcaacttgttcggtatccccatggttggccctgac
gtctgtggctttaatggcaacacggatgaagagctttgtaaccgatggatgcaacttggt
gctttcttcccatttttcaggaaccacaacatcaaatctgcaattagccaagagccttat
gtttgggactctgtccgtgatgccagtatcaaggccatcaacgcaaggtatcagatgttg
ccttactggtccacattattcgccaagtcctctcttgccggaactcctgccgttattccc
ctcttccatgagttcccctcccccagttaccttgacaacgactaccagttcctcattggt
ccctctgtacttgtcactccagtacttcaacctaacgagtcaactgtagttggccaattc
cccaccatgaatgatgttttctgggttgattggtggactcactgtaaacttgacacttct
tccggcgaagatgttactctcgatttgcctctcggaaacataggtgtgcacgtcaggagt
ggtagtgctttgttgctctacgacgagcctggttatactgtcaaggagacaaaagataat
ggttacgctatactggtcgtgcttgacggcaaaggttacgcggaaggcgatgccaaaatt
gatgatggtgaaagtttgcctgtcaccgaacagacttgcctcacatttaaatccactgat
tcctgcaaactctcttccacagctgtcggcagctacaccattgctggcaagctcaagact
attaccattgttggtgtttggactgaaccttccgaagtcaccctcaacggtagcaaggtc
caagatagccaggttgagtatgacaagagcttaggcagaatcaaaattaccggtcttgtt
caggacctcaattctgcctgggagcttatgtggtaa

DBGET integrated database retrieval system