KEGG   Cryptococcus neoformans var. neoformans JEC21: CNH01400Help
Entry
CNH01400          CDS       T00243                                 

Definition
(RefSeq) hexokinase, putative
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00010  Glycolysis / Gluconeogenesis
cne00051  Fructose and mannose metabolism
cne00052  Galactose metabolism
cne00500  Starch and sucrose metabolism
cne00520  Amino sugar and nucleotide sugar metabolism
cne01100  Metabolic pathways
cne01110  Biosynthesis of secondary metabolites
cne01130  Biosynthesis of antibiotics
cne01200  Carbon metabolism
Module
cne_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cne_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CNH01400
   00051 Fructose and mannose metabolism
    CNH01400
   00052 Galactose metabolism
    CNH01400
   00500 Starch and sucrose metabolism
    CNH01400
   00520 Amino sugar and nucleotide sugar metabolism
    CNH01400
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CNH01400
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cne04131]
    CNH01400
Enzymes [BR:cne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CNH01400
Membrane trafficking [BR:cne04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    CNH01400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 3259022
NCBI-ProteinID: XP_024513334
LinkDB All DBs
Position
8:join(774354..774620,774674..774704,774762..774806,774860..774942,774993..774999,775059..775078,775137..775297,775346..775436,775496..775512,775564..775586,775637..775725,775781..775975,776051..776093,776140..776195,776246..776403,776460..776676,776736..776859,776926..776972)
Genome map
AA seq 557 aa AA seqDB search
MSETPDQLATRVQNLSTAPTTTQRTGSGSAVLENGTNIGSAAGRKASIPAQVDPERIIST
SGSGRTSRRGSGLVMTPGGVQTVYHTRTNEDIEFPHAGKKTMADLLRKYESLFTLTPQRM
RMIVHAIEETLDNGLQKNGQVVPMIPTYVFGWPTGNEVGDFLALDLGGTNLRVCLVTLLG
SGKFEVTQTKYRLTEEQKQGEGQALLDFCAECLNSFIRDTLGRTEKDGILPLGFTFSYPC
SQDRIDHGVLIRWTKGFGAPNIEGYDVAAMFKDSLKRMDVPAELTALINDTTGTLIASNY
VDPHTKIAVIFGTGCNAAYMETAGSIPKIDYVGLPEEQGMAINCEWGAFDSFDHQHLPRT
KYDIIIDESSNKPGEQSFEKMIAGLYLGEIFRLVLCELIDSGDLFLGQNTYKLEKAYAFD
TAFLSLMEADVTEELLTIIGVFAHFFGLETTLEERQFFKKLAVLVGTRSARLSACGIAAI
VSKKGYLEEGCAVGADGSLYNKYPNFADRVHEALTDIFGESGKKIVTHHAEDGSGVGSAI
IAAMTKARKDSGFFVEY
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagacccccgaccagctcgcaacccgcgtccagaaccttagcacggcgcctaca
accacccagaggaccggctctggctctgccgttttggagaacggtacaaacattggctcc
gccgctggccgcaaggcctcgatccctgctcaggtagaccccgagagaatcatcagcacc
agtggcagtggccgaaccagcaggcgaggcagtggtttggtgatgactccaggaggcgtt
cagactgtataccacaccaggacaaatgaggatatcgaattccctcatgctgggaagaag
actatggccgatctcttgaggaagtacgaaagtctttttaccctgactccccagaggatg
aggatgatcgtccatgccattgaagagactcttgataacgggttgcagaagaatggacaa
gttgtgcctatgattcctacttatgtgtttggctggcctaccggtaacgaagtcggggat
ttcctcgctctcgaccttggtggtaccaatcttcgagtctgtctcgttactcttctaggc
agtggaaagtttgaagtcactcagaccaagtaccgattgaccgaggaacagaagcaaggc
gagggacaagctcttctggacttttgcgcagagtgtttaaacagcttcatccgcgatacc
ctcggccgcactgaaaaagacggtatcctcccccttggtttcactttctcctacccttgc
tctcaagaccgaattgatcacggtgttcttatccgttggaccaagggattcggtgctccc
aacattgaaggatacgatgtcgccgccatgttcaaggacagtctcaagcgtatggacgtc
cccgcggaactcactgctctcatcaatgacactaccggtactcttatcgcctccaactac
gttgacccccacaccaagatcgctgtcatcttcggaaccggctgtaacgctgcctacatg
gagaccgccggcagcatccccaagatcgactacgtcggattgcccgaggaacagggaatg
gctatcaactgtgaatggggagcgttcgactctttcgaccaccaacaccttccccgaacc
aagtacgacattatcattgatgaatcttccaacaagccaggagagcagtcctttgagaag
atgattgctggtctttaccttggtgaaatcttccgtctcgttctctgcgagctcatcgat
tctggtgaccttttcttgggtcagaacacctacaagctcgaaaaggcctatgctttcgac
accgctttcttgtctctcatggaagccgatgttaccgaagagcttttgaccatcatcggt
gtctttgctcacttcttcggccttgaaactacccttgaagagcgtcagttctttaaaaag
cttgctgtgttggtcggcacccgatctgctaggctttctgcgtgtggtatcgccgccatt
gttagcaagaaggggtacctcgaagaaggatgtgccgttggcgccgatggaagtttgtac
aacaaataccccaactttgcggaccgagttcatgaggcgcttacggacattttcggtgaa
agcggcaagaagattgtcacccaccatgctgaggatggttcaggtgtcggtagcgcaatc
attgccgcaatgaccaaggccaggaaggactctggattctttgtcgaatactaa

DBGET integrated database retrieval system