KEGG   Cryptococcus neoformans var. neoformans JEC21: CNH03700Help
Entry
CNH03700          CDS       T00243                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00250  Alanine, aspartate and glutamate metabolism
cne00410  beta-Alanine metabolism
cne00430  Taurine and hypotaurine metabolism
cne00650  Butanoate metabolism
cne01100  Metabolic pathways
cne01110  Biosynthesis of secondary metabolites
Module
cne_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CNH03700
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CNH03700
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CNH03700
   00430 Taurine and hypotaurine metabolism
    CNH03700
Enzymes [BR:cne01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CNH03700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 3259079
NCBI-ProteinID: XP_572532
UniProt: Q5K920
LinkDB All DBs
Position
8:join(48880..48962,49014..49144,49194..49221,49287..49404,49455..49709,49773..49840,49893..50024,50076..50129,50178..50295,50348..50414,50463..50826,50880..50987,51049..51163,51228..51260)
Genome map
AA seq 557 aa AA seqDB search
MALSQHVDADKLIEECKDHPIKRHLSHKAALYDIPYTSRYEVEDEVPRYRLPSKGVNGRA
TYQLLHDELMLDGNPNMNLASFVHTWVPDECNRLVQENINKNLVDQDEYPAAQQIHERCI
SMLSHLWHAPKEATAMGTATTGSSEAIMLGGLALKRRWQEKMKAAGKDIHNPGPNIVMGA
EAQVALEKFARYFEVEARLVPIKPESSYVMDPKDVLKYVDENTIGVFVILGSTYTGAFES
VKDVAQELDKYEAETGISVPIHVDAASGGFVAPFAYPHYQWDFQIPRVHSINASGHKYGM
STVGVGWIIWRSMEYLPKELIFELHYLGATDYSFNLNFSRPAHPILAQMFTFLNLGFEGY
KRIMDKNLTVARLISRALEHSGYFICLSKIHHPKALTESSSSAEQSNILPAVADAANTVL
HGKKTTVDDAEYYCEGLPVVSFMFTDEIKKKYPGVKQAWIQMQLRSIGWIVPNYPLAPDC
EKTEILRVVVRESLSGDLARKLIHDILQVTEDLLNDAGPSYSMSTATRRHENLDHGKLDN
IDAVHIKQHTSTYSKPC
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggccctctctcaacacgtagacgccgacaagctcattgaagagtgcaaagaccaccct
atcaagaggcaccttagtcataaggctgctctttatgatattccctacacttcccgctac
gaagttgaggacgaggttccgagatacaggctccccagtaagggtgtcaatggcagggct
acataccagctcttacacgatgagctgatgcttgatgggaaccccaacatgaatttggct
tcatttgttcacacttgggttcctgatgagtgcaaccgtcttgtccaggaaaacatcaat
aagaatctggtcgaccaggacgaataccctgctgctcaacagattcacgagcgatgtatc
tcaatgctctctcacctctggcacgctcccaaagaagccacggctatgggcaccgctact
accggttcctctgaagccatcatgcttggcggtctcgctctcaagcgccgatggcaggaa
aagatgaaagccgctgggaaagatatccacaaccccggacctaacatcgttatgggtgca
gaggctcaagtagctttggagaagtttgctagatactttgaggttgaggcgagacttgtg
cctattaagcctgagtcgagttatgtaatggaccccaaggacgtcctcaaatacgtcgat
gagaacacaattggtgtctttgttatcttgggatcaacttacaccggcgcgtttgaatcc
gtaaaagacgtggctcaagagctcgacaaatacgaggccgagacaggtattagtgtccct
atccacgttgatgccgcttctggtggttttgttgctccatttgcataccctcattaccag
tgggacttccaaattcctcgagtccatagtatcaatgcctcgggtcacaagtacggtatg
agcactgtgggtgtcggatggatcatctggaggtctatggagtaccttcctaaggagttg
atctttgagcttcactatctcggtgctaccgattattcatttaatctcaatttcagtaga
ccggcacaccctatcctcgcccagatgttcactttcttgaacctcggtttcgaaggttac
aagcgtataatggacaagaacctcaccgtagctcgtctcatctcccgagccctcgagcac
tctggctacttcatttgtctctccaagatccaccaccccaaggctcttaccgaatcctcc
agcagcgccgaacaatccaacatcctccctgccgtcgccgacgccgctaataccgttttg
cacggcaagaagactactgttgacgatgccgagtattattgcgagggtttgcccgttgtg
tcgtttatgtttacggacgaaattaagaagaagtaccctggtgtgaagcaggcgtggatc
cagatgcagctgaggtctatcggctggatcgtccccaactaccctctcgctcccgactgc
gagaaaactgagatcctccgagtcgtcgtccgagagtccctttctggtgacttggcgagg
aagctcatccacgacattcttcaggtaaccgaagatctcctaaatgacgctggaccttca
tactccatgtctactgctaccaggcgtcacgagaatttggaccacggcaagctggataat
attgatgctgtccacatcaagcaacacacttccacctattctaagccctgttag

DBGET integrated database retrieval system