KEGG   Cryptococcus neoformans var. neoformans JEC21: CNI03270Help
Entry
CNI03270          CDS       T00243                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit precursor, putative
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00020  Citrate cycle (TCA cycle)
cne00190  Oxidative phosphorylation
cne01100  Metabolic pathways
cne01110  Biosynthesis of secondary metabolites
cne01130  Biosynthesis of antibiotics
cne01200  Carbon metabolism
Module
cne_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cne_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cne_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CNI03270
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CNI03270
Enzymes [BR:cne01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CNI03270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA Lycopene_cycl FAD_binding_3 HI0933_like SecA_SW
Motif
Other DBs
NCBI-GeneID: 3259761
NCBI-ProteinID: XP_572631
UniProt: Q5KBA0
LinkDB All DBs
Position
9:complement(join(884308..884449,884509..884634,884690..884788,884844..885200,885251..885548,885600..886071,886124..886338,886613..886653,886726..886784,886927..887031))
Genome map
AA seq 637 aa AA seqDB search
MLALSRTRALARPLRNNFARNYVVASQTARATEAPNFGQKKGYPIIDHEFDAVVVGAGGA
GLRAAFGLAEGGLKTACITKLFPTRSHTVAAQGGVNAALGNMTEDDWRWHMYDTVKGSDW
LGDQDAIHYMCREAPHTVIELEHYGVPFSRTKEGKIYQRAFGGQSLKYGKGGQAYRCAAA
ADRTGHAILHTLYGQSLRHNTNFFIEYFALDLLMQDGECVGVLAINMEDGTLHRFRSHKT
VLATGGYGRAYFSCTSAHTCSGDGNAMAVRAGLPLQDLEFVQFHPTGIYGAGCLITEGSR
GEGGYLVNSEGERFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGPEKDHIFLQLSHLP
AEVLHERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTKYTGEVLTIDEQGNDKV
VPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACANHIKETLAPNTPHKPMNPELGKE
SIEDLDKIRNASGPLPTSQIRLNMQKTMQTDAAVFRTQQSLDEGVAKMREVYKSYDQVGI
KDRSMIWNSDLIETLELRNIMQNAMQTVVSAAARKESRGAHAREDYPERNDEEWMKHTLS
FQHDPNSPDVELKYRGVIANTLDEAECKPVPPFKRTY
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccctctctcgtacaagggccctcgcccgccccctccgcaacaacttcgcaagg
aactatgtcgtcgcttcccagacagcccgcgctacagaagctcccaacttcggccagaaa
aagggatacccaatcatcgaccacgagtttgacgctgtagttgtcggtgctggtggtgcc
ggtttgcgagctgctttcggtcttgccgagggtggactcaagaccgcctgtatcaccaag
cttttccccactcgatcccacactgtcgccgctcagggtggtgtcaacgctgctctcggt
aacatgacggaggacgactggagatggcacatgtacgacactgtcaagggttctgattgg
ttaggtgaccaggatgctatccactacatgtgtagggaggcccctcacactgttatcgaa
cttgaacactacggtgtgcccttctcccggaccaaggagggcaagatctaccagcgagct
ttcggtggtcagtctctcaagtacggtaagggtggtcaggcctaccgatgtgctgccgcc
gccgaccgaactggtcacgccattctccacaccttgtacggtcaatctctccgacataat
accaacttcttcatcgagtactttgctctcgaccttctcatgcaggatggcgagtgtgtt
ggtgtgcttgctattaacatggaggacggtaccctacacagattccgaagccacaagact
gtcttggctacaggtggttacggccgagcgtatttctcctgtacttctgcccacacctgt
tccggtgacggtaacgcgatggccgtgagggctggtttgcctttgcaagatttggagttt
gttcagttccaccctactggtatttacggcgcaggttgtcttatcactgagggttctcga
ggtgagggtggttacctcgtcaactctgagggtgagcgattcatggagcgatacgccccc
accgccaaggaccttgcttctcgagatgtcgtctcccgatccatgaccctcgaaatccga
gaaggtcgaggtgtcggccccgagaaggaccacatcttcctccaactcagtcacttgcct
gccgaagtcttgcacgaacgattgcctggtatctctgagaccgctgctatctttgccggt
gtcgatgttaccaaggagcctatcccagttttgcctactgtccattataacatgggcggt
attcccactaaatacaccggcgaagtcctcaccatcgatgagcaaggcaacgacaaggtc
gttcccggtctttatgccgccggcgaagccgcctgtgtctctgtccacggtgctaaccga
ctcggtgccaactccttgctcgacattgtcgtctttggccgtgcttgcgcaaaccacatt
aaagaaactcttgcccccaacactcctcataagcctatgaaccccgagcttggcaaggag
tctattgaggatcttgacaagattaggaatgctagcggtcctttgcctacttcccagatc
aggttgaacatgcagaagacaatgcagaccgacgccgccgtcttccgaactcaacaatct
ttggacgagggtgttgctaagatgagggaagtctacaagtcttacgaccaggtcggtatc
aaggacaggagtatgatctggaactccgacctcattgagaccctcgagcttaggaacatt
atgcagaacgccatgcagactgtcgtttcagctgctgctaggaaggagtctcgaggtgcc
cacgcccgagaggactaccccgagcgtaacgacgaggagtggatgaagcacaccctttcc
ttccagcatgatcccaactcccccgacgtcgagctcaaataccgaggcgttattgccaac
actcttgacgaggctgagtgcaagcccgttcctcctttcaagcgaacttattaa

DBGET integrated database retrieval system