KEGG   Cryptococcus neoformans var. neoformans JEC21: CNK02140Help
Entry
CNK02140          CDS       T00243                                 

Definition
(RefSeq) conserved hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cne00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CNK02140
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cne02000]
    CNK02140
Enzymes [BR:cne01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CNK02140
Transporters [BR:cne02000]
 Other Transporters
  Pores ion channels [TC:1]
   CNK02140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 3254540
NCBI-ProteinID: XP_567689
UniProt: Q5K9F3
LinkDB All DBs
Position
11:complement(join(633689..633747,633797..633836,633901..633933,633987..634054,634111..634189,634240..634344,634403..634474))
Genome map
AA seq 151 aa AA seqDB search
MSAITLPAAFPVVGIPIFATFLLNTWQQILVMKARKESGVKYPTLYVPEAEAAADAKKMK
FNCCQRAHANTLENIPYVLAFFGFLSVFHPKIASAAMLMWVIGRVQYTAGYASGDPAKRI
GNIYRISYLGFFTLAFGTLGVAVQKSCSVLF
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccatcacccttcctgccgctttccccgtcgtcggtattcctatcttcgctacc
tttctcctcaacacgtggcagcaaattcttgtcatgaaagcgcgtaaggagtctggcgtc
aagtaccctacattatatgtccccgaggccgaggctgctgccgatgctaaaaagatgaaa
ttcaactgctgccagcgtgctcacgccaacactctcgagaatattccctacgtcctcgct
ttctttggtttcctcagcgttttccaccccaagatcgcctccgctgccatgctcatgtgg
gttattggccgcgtccaatacactgcaggctacgcttctggtgaccccgcaaagcgtatc
ggcaatatctacaggatctcgtatcttgggtttttcacccttgccttcggaactcttggt
gttgcagttcaaaagagctgctcggtcctcttctaa

DBGET integrated database retrieval system