KEGG   Cryptococcus neoformans var. neoformans JEC21: CNN00140Help
Entry
CNN00140          CDS       T00243                                 

Definition
(RefSeq) hydrolase, putative
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00052  Galactose metabolism
cne00500  Starch and sucrose metabolism
cne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CNN00140
   00500 Starch and sucrose metabolism
    CNN00140
Enzymes [BR:cne01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     CNN00140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-GeneID: 3255537
NCBI-ProteinID: XP_024514033
LinkDB All DBs
Position
14:join(48921..48999,49058..49065,49138..49274,49329..49464,49519..49649,49715..49880,49926..50086,50136..50231,50289..50387,50470..50794,50851..51022,51083..51348)
Genome map
AA seq 591 aa AA seqDB search
MIPPLDDSSLVKAADKAWWKSATVYQVYPASFCDHADAGHGTLLGILTKVDYLQSLGVDI
VWLSPIYESPQADMGYDISNYRQIDKRYGSLEDWDRLLAALHQRGMKLVMDLVVNHTSDQ
HPWFKESRSSRDNPKRDWYIWRPPRYNEKNERIPPNNWKGTFGQGSAWEFDETTNEYYLH
LFLKEQPDLNWENPQVRAEVYDLMHWWLKRGADGFRMDVINFIAKAPGLPDAPVIDPGRT
YQSFGMMSINRPEVHGWLKEMNRAVLSHYDCFAVGECPGDEAVVSYAPYSVPHNKELQMV
FHFHHQSFDRAAGGLGRVHNPDWKLSELKRVFNTWQIDLENHDQPRIISRMASDHPSDRA
RCAKLLAMFHCSLGGTIYVYQGQELGMINVPRGWGLVEYKDVETIQNSEAEVQHRQVICG
HANPDISDLLESNRITARDNGRTPMQWDSSLNAGFSKGEPWMRIHDDYREGWNAAAQVND
PDSAWSFWKQMLRLRKKYDAMIYGDFIALDESNEETYAYIREHPPSGQKLLVVLNLSRGN
DGRGAPSTFVLPCGLDTSGSKLLISNGEVQEGQRIEGNILLGPWEGRIYLL
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgattcccccgctcgacgactcgtccctggtgaaggccgcggataaagcctggtggaag
tcagcgaccgtctatcaagtctatcctgcatcattctgtgaccatgccgatgcaggccac
ggcaccctcctcggcatcctcaccaaggtggactacctgcaatcactgggagtcgacatc
gtttggctttctcctatatacgagtccccccaggcagatatgggctatgacatttctaac
taccgtcagatcgataagcggtacggctcgcttgaggattgggatagactactggctgcg
cttcaccaacgaggcatgaaacttgttatggacttggttgtgaaccacacctcagatcag
cacccatggttcaaagagtcgcgcagttcccgagacaatcccaagagggattggtacatt
tggcggccacctcgatacaatgagaagaacgagaggatccccccgaataactggaaaggc
actttcggccagggatcagcgtgggaattcgacgagaccaccaacgagtactacctccat
ctcttcctcaaggaacagcccgaccttaactgggagaaccctcaggtcagggccgaggtt
tatgatcttatgcactggtggctcaagaggggtgccgatgggttccgtatggacgtaatc
aactttatcgccaaggcacccggtctgccagatgcgccggtcatcgacccgggacggacg
tatcagtcgtttgggatgatgtcgataaaccgtccagaggtgcatggatggctgaaagaa
atgaatcgcgcggtactctcacactatgattgcttcgccgtgggagaatgtccaggtgac
gaggccgtagtgtcatatgccccttattctgtgccccacaataaggagctacagatggtc
tttcattttcaccatcagagcttcgatagggcggctggcgggctgggacgagttcacaat
cctgattggaagctgtccgagttgaaaagggtcttcaacacctggcagatcgatcttgag
aatcacgaccagcctcggatcatctcccggatggcatctgaccatccttcggacagggca
cggtgtgcgaagctattggcgatgttccattgctcccttggcggtacaatatacgtttat
caagggcaggagctcgggatgatcaatgttccgcgtggctggggactggtggagtacaaa
gatgtcgagactattcaaaactctgaggccgaggtgcagcatcgacaagtgatatgcggc
catgcgaatccggacatatccgacttgcttgagagcaaccgcattacagctagggacaac
ggtcgcactcccatgcagtgggactcaagtctgaatgccgggttctcaaagggcgagccg
tggatgcgtatacacgatgactaccgcgagggctggaacgctgccgctcaggttaatgat
ccggactcggcatggtctttctggaagcagatgctccgcctgagaaagaagtacgacgcc
atgatatacggcgacttcatcgcgctggacgagtcgaacgaggaaacttacgcatatatc
cgcgagcaccctccgagcgggcagaagctcctcgtcgtcctcaatctttcccgcggaaat
gacggtcgtggtgcaccctcgacttttgtgctcccatgcgggctcgatacaagcggcagc
aagctattgatctctaatggcgaggtacaagagggccagcgaatcgaggggaatatactt
ttgggcccatgggaaggcaggatctacctcttatga

DBGET integrated database retrieval system