KEGG   Calditerrivibrio nitroreducens: Calni_1047Help
Entry
Calni_1047        CDS       T01364                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
cni00970  Aminoacyl-tRNA biosynthesis
cni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cni00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Calni_1047
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cni03029]
    Calni_1047
Enzymes [BR:cni01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Calni_1047
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Calni_1047
Mitochondrial biogenesis [BR:cni03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Calni_1047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ADR18958
UniProt: E4TI42
LinkDB All DBs
Position
complement(1099488..1100924)
Genome map
AA seq 478 aa AA seqDB search
MKFEPVIGLEVHVQLNTNTKIFCSCPTTFGEEPNTNVCPVCLGMPGVLPVLNEKVVEYTV
KAGLALNCKIQQKSVFARKNYFYPDLPKNYQISQFELPICLDGFVDIDTENGVKRIGITR
IHMEEDAGKLIHGENLGNPNSSYVDYNRTGTPLMEIVSEPDMRSSEEAKAYLEKLKLILE
YTGVSDCSMEKGSLRCDANVSVRPIGQKEFGTKVEIKNMNSFKNVQKAIDYEIRRQISEI
ESGNIIVQETRLWDPEKGITISMRSKEESHDYRYFPDPDLVPVVVTKDMIDSIKKTLPEM
PDKVLAKLISDYNLPEYDASVLVSSKELSDFFFETSKLTKNYKAISNWIQTEIMRVMNEK
DCLINEVGISPAHLSELITLVDENVISLKIAKSLFDDILKEKRSPRELVKEKGLVQIADE
GALEEVVKKVLSACSKEVERYKNGETKLIGFFVGQIMKETKGKANPKIVNELLTKLLS
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgaaccagttatcggattggaggtacatgttcaattaaatacaaatacaaag
atattctgttcatgtccaactacttttggagaagaacccaatacaaatgtttgccctgta
tgtctggggatgcccggtgttctgccggtactaaatgaaaaagtggtggagtacactgta
aaggctggacttgctttaaactgcaaaatacaacagaagtctgtttttgcaagaaaaaac
tatttttatccggatcttccaaaaaactatcaaatttcacaatttgaattacctatctgt
ctggatggttttgtggatatagatactgaaaatggtgtaaaaaggataggtatcacccga
attcacatggaggaagatgctggtaagcttatccatggtgaaaatcttggaaatccaaat
tccagctatgttgattacaatagaacaggtactcctctgatggagatcgttagtgaaccc
gatatgagaagctctgaagaggcaaaagcttatctggaaaagttaaaacttatccttgag
tatacaggcgtatcagattgtagtatggaaaaaggttctttgagatgtgatgcaaatgta
tccgttaggcctattggacaaaaagagtttggaactaaagtggaaataaaaaacatgaac
tcctttaaaaatgttcaaaaagctattgattacgaaataagaagacagataagcgaaata
gaaagtggcaacattatcgttcaggaaacaaggctttgggatcctgaaaaagggataaca
atttcaatgagaagcaaggaagaatcacatgattacaggtattttccagatccagattta
gtccctgtggttgttacaaaagatatgatagattcaataaaaaagacgctaccagaaatg
ccagataaagttctggcaaagttgataagtgactacaatcttccggaatatgatgcatcg
gttttagtatcttctaaagagttatcagattttttctttgaaacttcaaagttaacaaaa
aattacaaagctatatccaattggatacaaactgagatcatgagagtcatgaatgaaaaa
gactgcttgatcaacgaagtggggatatctcccgcccatttgagtgagcttattacattg
gttgacgaaaatgtcatatctcttaaaatagcaaagtcactatttgatgatattttgaaa
gaaaagagatcccccagggaattggtaaaagaaaaaggtctcgttcagatagctgatgaa
ggtgctctggaagaggtggtaaaaaaagttttatcagcttgctcaaaagaggtggagagg
tacaaaaatggtgagacaaagttaatcggtttctttgttgggcagattatgaaagaaacc
aagggtaaagcaaatccaaaaattgtaaatgaacttttaacaaaacttttaagttag

DBGET integrated database retrieval system