KEGG   Clostridium novyi: NT01CX_0344Help
Entry
NT01CX_0344       CDS       T00431                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cno  Clostridium novyi
Pathway
cno00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NT01CX_0344
Enzymes [BR:cno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     NT01CX_0344
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     NT01CX_0344
    1.1.1.-  
     NT01CX_0344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ApbA 2-Hacid_dh_C Shikimate_DH Pyr_redox_3 PALP FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABK62405
UniProt: A0Q2I7
LinkDB All DBs
Position
complement(2033086..2034165)
Genome map
AA seq 359 aa AA seqDB search
MKAALWYGKNDVRVEEVQEPKVENGTVKIKVKWCGICGSDLHEYLNGPIFIPVEQPHPLS
GNVAPIILGHEFSGEIVEVGEGVKKFNIGDRVIVEPIVACGKCPACKEGKYNLCTSLGFH
GLCGSGGGFAEYTVFPEEFVHKIPDNMTYEQAALAEPMTVALHSIRVANFKTGDTALVLG
AGPIGLATIECLKAAGAKSVIVFQRKSIRQEYAKRAGADIVLDPNEVNVSEEVKKITGGL
GVDTAFETTGAQVGFDVGIESLKFEGTMVITSIWEKEIKFNPNTLVFSEKKIVGTLAYRH
EFPSIIAQMNDGRIKAEGYITKKISLDNIVAEGFNTLTGLEKKKQVKILVTPDEMLLDK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggcattatggtatggaaaaaatgatgttagagtagaagaagttcaagaacca
aaagtagaaaatggaacagttaagattaaggttaaatggtgtggaatttgtggatctgat
ttacatgaatatttaaatggacctatatttatacctgttgaacaaccacatcctttaagt
ggaaatgttgcacctataatattaggtcatgaattttcaggagagatagtagaagttgga
gaaggtgttaagaaatttaatattggggatagagttattgttgaaccaatagtagcttgt
ggaaaatgtcctgcatgtaaagaaggaaagtataatctttgtacatcattaggatttcat
ggtctttgtggaagtggtggtggatttgctgaatacactgtatttccagaagaatttgtt
cataaaatcccagataatatgacttatgaacaagcagcgttggcagaaccaatgactgtt
gcattacattctataagagtggcaaactttaaaacaggggatactgcattggttttaggg
gctggacctataggattagcaacaatagaatgtttaaaagctgcaggagctaaatcggtt
atagttttccaaagaaaatctataagacaagagtatgctaaaagggctggggcagatatt
gtacttgatccaaatgaagttaatgtttcggaagaagttaagaaaattacaggaggactt
ggtgttgatactgcttttgaaacaacaggagctcaagttggttttgatgtaggaatagaa
agtttaaaatttgaaggtactatggtaataacgagtatatgggaaaaagaaattaagttt
aatccaaatacattggtatttagtgaaaagaaaatagtaggaactttagcatatagacac
gaattcccttcaataattgctcagatgaatgatggtagaataaaggcagaaggatacatt
acaaaaaaaatatctttagacaatatagttgcagaaggatttaatactttaacaggatta
gaaaagaaaaaacaagttaagatattagtaacacctgatgaaatgcttttagataaataa

DBGET integrated database retrieval system