KEGG   Clostridium novyi: NT01CX_0473Help
Entry
NT01CX_0473       CDS       T00431                                 

Definition
(GenBank) Acyl-CoA dehydrogenase, short-chain specific (SCAD)(Butyryl-CoA dehydrogenase)
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
cno  Clostridium novyi
Pathway
cno00071  Fatty acid degradation
cno00280  Valine, leucine and isoleucine degradation
cno00410  beta-Alanine metabolism
cno00640  Propanoate metabolism
cno00650  Butanoate metabolism
cno01100  Metabolic pathways
cno01110  Biosynthesis of secondary metabolites
cno01120  Microbial metabolism in diverse environments
cno01130  Biosynthesis of antibiotics
cno01200  Carbon metabolism
cno01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    NT01CX_0473
   00650 Butanoate metabolism
    NT01CX_0473
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NT01CX_0473
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NT01CX_0473
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NT01CX_0473
Enzymes [BR:cno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     NT01CX_0473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_2 Acyl-CoA_dh_M
Motif
Other DBs
NCBI-ProteinID: ABK62038
UniProt: A0Q2U2
LinkDB All DBs
Position
complement(2158088..2159227)
Genome map
AA seq 379 aa AA seqDB search
MKLEFTREQELVRQMVREFAENEVKPMAAEIDETEAFPMENVKKMAKYGMFGIPFAKEYG
GVGGDYLSYILAVEELAKKCGTTSIILSAHVSLCASVIDAFGTEEQKKKYLPDLCSGKKL
GAFGLTEPNAGTDASGQQTVAVKQGDKYILNGQKIFITNGGVADVFIAFAMTDKSKGTKG
ISAFIVEKGFKGFSIGKVEDKLGIRASSTTELIFEDCEVPAENLIGKEGKGFAIAMKTLD
GGRIGVSAQALGIAEGALEEAIEYMKERKQFGKQLYKFQGMGWMAAECKAKIEAARYLVY
KAAYNKMTGKPYTVEAATAKLFAADTAMEVATKAVQMFGGYGYTKDYPVERMFRDAKITE
IYEGTSQVQKMVISGALFR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaagttagaatttactagagaacaagaattagtaagacaaatggttagagagtttgct
gaaaatgaagttaaaccaatggcagctgaaattgatgaaactgaggcgtttccaatggaa
aacgttaaaaaaatggctaagtacggaatgtttggaattccattcgctaaagaatatggt
ggagttggtggagactacttatcttatatattagcagtagaagaattagctaaaaagtgc
ggaacaacaagtataatactttctgctcatgtatcactttgcgcttctgtaatcgatgcc
ttcggtacagaagaacaaaaaaagaaataccttccagatttatgttcaggaaaaaaacta
ggagcattcggattaactgaaccaaatgccggtactgatgcatcaggacaacaaactgta
gcagttaaacaaggagataaatatatcttaaatggacaaaaaatattcataacaaatggt
ggagttgctgatgtatttatagcatttgctatgactgataaatcaaaaggaacaaaagga
atctcagcatttatagttgaaaaaggattcaaaggattctcaataggtaaagtagaagac
aagctaggaattagagcatcatcaactacagaacttatttttgaagattgtgaagttcca
gctgaaaacttaataggaaaagaaggaaaaggattcgcaatagctatgaagactcttgat
ggaggaagaataggggtatctgctcaagcattaggtattgctgaaggagctttagaagaa
gctattgaatacatgaaagaaagaaaacaattcggaaaacaattatacaaattccaaggt
atgggatggatggctgcagaatgcaaagctaagatagaagcagctagatatttagtatac
aaagcagcttataacaaaatgacaggaaaaccttatactgttgaagcagctacagctaaa
ttatttgcagcagatactgcaatggaagttgcaactaaggctgttcaaatgtttggtgga
tatggatacactaaggactatccagtagaaagaatgtttagagatgctaagatcactgaa
atctacgaaggaacatctcaagttcaaaagatggttatttcaggagcattattcagataa

DBGET integrated database retrieval system