KEGG   Clostridium novyi: NT01CX_1264Help
Entry
NT01CX_1264       CDS       T00431                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cno  Clostridium novyi
Pathway
cno00473  D-Alanine metabolism
cno01100  Metabolic pathways
cno01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NT01CX_1264
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    NT01CX_1264
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cno01011]
    NT01CX_1264
Enzymes [BR:cno01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     NT01CX_1264
Peptidoglycan biosynthesis and degradation proteins [BR:cno01011]
 Precursor biosynthesis
  Racemase
   NT01CX_1264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABK61810
UniProt: A0PY95
LinkDB All DBs
Position
384577..385740
Genome map
AA seq 387 aa AA seqDB search
MFKHLRPVWAEINLDNLASNMKHIKELSNTKEIIGIVKADAYGHGALDIVPTLIENGATA
LAVAVVSEGVELRRGGIECPIMVLGFTPPSLIDMLLKHDIEQTVFSLDYAKELSKAAEKM
HKVAKIHIAVDTGMGRIGFLPNEQSIQDVKAISMLPNIKIKGMFSHFSTADEKNKEYSAY
QLNQFNKFYEGLKRENVNIETRHISNSAAIMDLPETIFEGVRPGIILYGYYPSNEVDKTK
LELKPVMQLKTNVVHIKKIPSGEYISYGRKFKTDRESLIATLPVGYADGYTRLLFGKAKV
IINGQLAPVVGRICMDQCMVDITDIKGDIKVGEEVILIGEKNGVKIDADDIAEMLGTINY
EVICMISKRVPRVYIKNGEVIKVRNYI
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaacatttaagaccagtttgggcagagataaatttagataatcttgcttcaaat
atgaaacatataaaagagctatcaaatactaaggaaataataggaatagtaaaagctgat
gcatatgggcatggagctttagatatagttcctacacttatagaaaatggagcaacagca
cttgctgtagctgttgttagtgaaggagtagaattaagacgtggaggaatagaatgtcct
ataatggttttagggtttactccaccaagcttaattgacatgttattaaaacatgatata
gaacaaacagtattttctttggattatgcaaaggaactttcaaaagctgctgaaaaaatg
cataaagttgctaaaattcatatagcagttgatacaggtatggggagaataggattctta
cctaacgaacaaagcatacaagatgttaaagcaataagtatgcttcctaacataaaaata
aagggtatgttttcacatttctcaacagcagatgagaaaaataaagaatatagtgcttat
caattaaaccaattcaacaagttttatgaaggtttaaaaagagaaaatgtaaatatagaa
actagacacatatcaaatagtgctgcaataatggacttaccagaaactatatttgaaggg
gtaagaccaggcataatattatatggatattatccatcaaatgaagtagataaaactaaa
ctagaattaaaaccagttatgcaattaaaaactaatgtggttcacataaaaaagatacct
tctggagaatatataagttatggaagaaagtttaagacagatagagaaagtttgatcgca
acattgccagttgggtatgctgatggatacactagattattgtttggtaaagcaaaagtt
ataataaatggacagttagcaccagtagtgggaagaatatgcatggatcaatgtatggtt
gatataactgatataaaaggtgatataaaagtaggagaggaagtaatcctaataggagaa
aaaaatggagtaaagatagatgcagatgatattgcagaaatgctaggtactataaattat
gaagttatttgcatgattagtaaaagagttccaagagtgtacataaaaaatggagaagtg
ataaaagttagaaattatatttaa

DBGET integrated database retrieval system