KEGG   Clostridium novyi: NT01CX_1771Help
Entry
NT01CX_1771       CDS       T00431                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cno  Clostridium novyi
Brite
Enzymes [BR:cno01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NT01CX_1771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ABK60604
UniProt: A0PZP2
LinkDB All DBs
Position
complement(974053..974628)
Genome map
AA seq 191 aa AA seqDB search
MYFNFEYPYFDTCYPYPRTPYTNFYRNSSLDTNVKRPNINIAVSYIKGGPSYPNIKGIVS
FVSVPGGTEVSVYVEGLPNYKPATKTTQPIGPFGFHIHSVGCCDIGNPNDPFTCASGHWN
PDNQPHGNHAGDFPVLFSNHGMCKMSFFTDRFKPKDIIGLSVIIHESPDDYRSQPSGNSG
KRIACGIIKTI
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgtattttaactttgaatatccttactttgatacgtgttacccttatccacgtactcct
tatactaatttttatagaaattcatccttagacactaatgtaaaaagacctaatataaat
attgctgtgtcttatataaaaggtggtccaagttatcctaatataaaaggaatagtttct
tttgtgtctgtaccaggaggtactgaagtttctgtatacgttgaaggtcttccaaactat
aaaccagcaaccaaaacaactcagcctataggtcctttcggctttcacattcattctgta
ggttgttgtgatattggtaatcctaatgatccttttacctgcgcaagtggccattggaat
ccagataatcaaccccatggcaatcacgctggagattttccggttttattttctaatcat
ggaatgtgtaaaatgagcttttttacagataggtttaaacctaaagacataattggctta
tcagtaattatacacgaaagtcctgatgactatagaagccaaccttctggcaattcagga
aaaagaattgcttgtggaattataaaaaccatttag

DBGET integrated database retrieval system