KEGG   Clostridium novyi: NT01CX_2239Help
Entry
NT01CX_2239       CDS       T00431                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cno  Clostridium novyi
Brite
KEGG Orthology (KO) [BR:cno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cno01001]
    NT01CX_2239
Enzymes [BR:cno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     NT01CX_2239
Protein kinases [BR:cno01001]
 Serine/threonine kinases: Other
  Bacterial family
   NT01CX_2239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr RIO1 DUF4366 Kinase-like Haspin_kinase Pkinase_fungal Kdo APH
Motif
Other DBs
NCBI-ProteinID: ABK61623
UniProt: A0Q110
LinkDB All DBs
Position
complement(1428760..1430688)
Genome map
AA seq 642 aa AA seqDB search
MTGTILGNRYELLQKIGEGGMAEVYKAKCHLLNRFVAVKVLKSQYSDDIEFVNKFKQEAS
SAASLSHNNIVGIYDIGSENNINYIVMEYIDGKTLKQIINENGSLGFNASIDIAIQIAKA
LECAHNNNIIHRDVKPHNILVTRDRNIKVTDFGIAKATSSVTITNSDKIIGSAHYISPEQ
AKGRFVDCKTDIYSLGIILYEMVTGKVPYDGESPVSVALKHVQEELIPPIKVNPNIPESL
NKLILKAVEKEPYKRYQSAHDMIIDLNKVKQNPNVNIAANVDENEYTKIMKPIADVDEKE
PDLYDDIEDEDNEEVEELKGREFEDKREKKEKKPKGSSKSKKKILGGIIGLAVLIICVVG
IFMVAGGSKKTGKVNVPNIIGLTSDKAEKLVKDAGLKFVVKEEPSDKPKGVVIKCYPSPG
TTMDLSENNEVRVIISSGSENTGVPNLVDIDFETAKEYLNMYNLKLGEVTYKYSNSVEKG
KVCDQSPKAGSEIKPDTTVDLVISKGSQLKMTTVPNLINKKLDEVEGIVSSAGLRLGTVN
KIPTTDKEKDGLVTVQSIESGTRVKQQTIINISCYSFGNKDIVKVPNFVNKTVKEARILA
EQNDLSISFRGRDDFIIVSQDKAPGSQVAEGTSISLKTEPNP
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgactgggactattctaggaaatagatatgaattattgcaaaaaattggtgaaggaggt
atggctgaagtatataaggctaaatgtcatttattaaatagatttgtagctgtaaaagtt
ttaaaaagtcagtattcagatgatattgagtttgtcaacaagtttaaacaagaagcatct
tccgcagctagtttatcgcataataatatagttggaatttatgatattggatcagaaaat
aatataaattatattgtaatggagtacatagatggtaaaacattaaaacaaatcataaat
gaaaatggaagtttaggatttaatgcatcaattgatattgcaattcaaattgctaaagct
ttagaatgtgctcataataacaatattattcacagagatgttaagcctcataatatttta
gtaacaagagatagaaatataaaagtaactgattttggaatagctaaagcaacatcatct
gttactataacaaattcagataaaattataggatcagcacattacatttctcctgaacaa
gcaaaaggaagatttgttgattgtaaaacggatatttattctttaggaataattttatat
gaaatggttacaggaaaagtaccttatgatggagaaagtcctgtatcagtagctttaaaa
catgttcaagaggaacttatacctcctataaaggtgaatcctaatataccggaaagctta
aataaactcatattaaaagctgtagaaaaggaaccatataaaagatatcaaagtgcccat
gatatgattatagatttaaataaggtaaaacaaaatccaaatgttaatatagctgctaat
gttgacgaaaatgaatatacaaaaataatgaagcctatagcagatgttgatgaaaaagag
cctgatttatatgatgatattgaagatgaagataatgaagaagtagaagaattaaaaggt
agagaatttgaagataaaagagagaaaaaagagaaaaagcctaaaggttctagtaaaagt
aagaaaaaaatactaggtggaattatagggcttgctgttttaataatatgtgttgtagga
atatttatggttgcaggtggtagcaaaaaaactggaaaagttaatgttcctaatataata
ggattaacatcagataaagctgaaaaacttgtaaaagatgctggacttaaatttgtagta
aaggaagaaccaagtgataagccaaaaggagttgtaataaagtgttacccatctccaggt
actactatggacttaagtgaaaataatgaagtaagagttataataagttctggaagtgaa
aacacaggagtacccaatttggtagatattgattttgaaacagctaaagaatatttaaat
atgtataacttaaaacttggggaagttacttataaatatagtaatagtgtagaaaaagga
aaagtatgtgatcaatctccaaaggctggatcagaaataaaaccagatacaacagtagat
ttagttataagtaagggatcacaattaaaaatgacaacagtaccgaatttaattaataag
aaattagatgaagttgaaggaatagtatcaagtgctggattaagattaggtacagtaaat
aaaatacctactacagataaagaaaaagatggattagttacagttcaaagcatagaatca
ggtacaagagtaaaacaacagacaattattaacataagttgctattcttttggaaataag
gatatagtaaaggtaccaaacttcgtaaataaaacagtaaaagaggctagaatacttgct
gaacaaaatgatttatccataagttttagaggaagagatgattttataatagtatctcaa
gataaagcacctggttcacaagttgcagaggggacatctattagtttaaaaactgaacca
aatccataa

DBGET integrated database retrieval system