KEGG   Cloacibacterium normanense: EB819_02655Help
Entry
EB819_02655       CDS       T05730                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cnr  Cloacibacterium normanense
Pathway
cnr00564  Glycerophospholipid metabolism
cnr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cnr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EB819_02655
Enzymes [BR:cnr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     EB819_02655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 NAD_binding_8 HI0933_like Pyr_redox_3 Pyr_redox GIDA FAD_binding_3 GTF2I Thi4
Motif
Other DBs
NCBI-ProteinID: AZI68832
LinkDB All DBs
Position
complement(541276..542844)
Genome map
AA seq 522 aa AA seqDB search
MLRTEILKNFEDQNQTTWDFVIIGGGATGLGTAIEAATRGYKTLLLEQSDFAKSTSSKST
KLVHGGVRYLAQGYVDLVREACKERGLLLQNAPHLTKNLSFVIPIYTWRDKLLYTVGLKF
YDLLAGKLSLGKSVPISKSETIKRLPTIKKEGLKGGILYHDGQFDDSRLALNMAQTAIEN
GATVLNYAKVIKLKKDANGKLNGVIFQDTETGKEFETKTKVIVNATGVFADDINKMDHGT
DDKTISPSQGVHIMIDKKFCPTDSAIMIPKTSDGRVLFAVPWHNKIILGTTDTPVKQESL
EPKPTEQEINFILETARGYMNPAPTRKDILSVFAGLRPLAATKEGAKTKEVSRSHKIITS
KSGLVSIIGGKWTTYRKMGEDVVEKAEEIMKVPHKKSNTEHLKIHGYRKDIDYKDPMYYY
GTDKEKILELSKEIENGNEIISKEQNIIKAQIVWAVKKEMAINIEDFLSRRTRLLLLNQK
EAVRIAPIVAEVMAKELGKDEVWQKNQIESFKNIAEIYHTHI
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgttacgaacagaaattttaaagaacttcgaagaccaaaaccaaacaacatgggacttc
gtaataataggaggaggagccacaggcttaggaacagcaattgaagctgcaacaagagga
tataaaactttgcttttagaacaaagtgattttgcaaaatctacatctagtaaaagtaca
aaacttgtacacggaggtgtaagatatttagctcaaggatatgtagacctagtaagagaa
gcatgtaaagaaagaggattattacttcaaaacgcaccgcatcttaccaaaaatctttct
ttcgtaatcccaatttacacttggagggacaaactattatacacagttggtttaaaattt
tacgatcttttagctggtaaactcagcttaggaaaatctgttccgattagcaaatcagaa
acgataaaaagattaccaaccatcaaaaaagaaggattaaaaggaggaattctttatcac
gacggacaattcgacgattctagacttgccctaaacatggctcaaaccgctattgaaaac
ggtgctacagttttaaattatgctaaagttattaaacttaaaaaagacgccaacggaaaa
ttgaacggagtaatctttcaagacaccgaaaccggtaaagaatttgaaacgaaaacgaaa
gtaatcgtaaatgcaactggagtttttgcagacgatattaataaaatggatcacggaact
gacgacaaaaccattagcccaagtcaaggtgtgcatattatgattgataaaaaattctgt
ccaacagattctgcaatcatgattccaaaaacatcagacggaagagttctttttgcagtt
ccttggcacaataaaattattttaggaactacagacactcctgtaaaacaagaatctcta
gagccaaaaccaacagagcaagagattaatttcattttagaaacagcaagaggatatatg
aatcctgcaccaacaagaaaagacattttgagcgttttcgcaggtttaagacctttagcg
gcaaccaaagaaggcgctaaaaccaaagaagtatctagaagccacaaaataatcacttca
aaatctggattggtaagtattattggtggaaaatggacaacttaccgtaaaatgggcgaa
gatgtagtagaaaaagccgaagaaattatgaaagttcctcataaaaaaagcaatacagaa
catcttaaaattcatggatacagaaaagacatagattacaaagatccaatgtattactat
ggtacagacaaagaaaaaatattagaattatcaaaagaaattgaaaacggaaatgagata
attagcaaagaacaaaacattattaaagcgcaaattgtttgggctgtaaaaaaagaaatg
gcaattaacattgaagattttttatctagaagaacaagattattacttctaaaccaaaaa
gaggctgtaaggattgctccaattgttgccgaagtaatggctaaagaacttggaaaggat
gaagtttggcaaaaaaaccaaatagaaagtttcaaaaatattgcagaaatataccataca
catatttag

DBGET integrated database retrieval system