KEGG   Cedecea neteri SSMD04: JT31_03120
Entry
JT31_03120        CDS       T03298                                 

Gene name
tppB
Definition
(GenBank) peptide ABC transporter permease
  KO
K03305  proton-dependent oligopeptide transporter, POT family
Organism
cnt  Cedecea neteri SSMD04
Brite
KEGG Orthology (KO) [BR:cnt00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    JT31_03120 (tppB)
SSDB
Motif
Pfam: PTR2 MFS_1
Other DBs
NCBI-ProteinID: AIR03639
UniProt: A0A089PZG3
LinkDB
Position
690883..692388
AA seq 501 aa
MSTANKEPAENVSLNAFKQPKSFYLIFSIELWERFGYYGLQGIMAVYLVKMLGMSEADSI
TLFSSFSALVYGLVAIGGWLGDKVLGTKRVIMLGTVVLAIGYALVAYSGHDVSVVYIGMA
TIAVGNGLFKANPSSLLSTCYEKDDPRLDGAFTMYYMSINIGSFFSMLATPWLAAQYGWS
TAFSLSFVGMLITLVNFIFCKKWVKNYGSKPDFAPVHFGKLMATIAGVVVLVAVATWLLH
NQGIARAVLGVVALGIVLIFAKEAFAMKGAARRKMIVAFILMVEAIVFFVLYSQMPTSLN
FFAIRNVGHEILGITFEAEQFQALNPFWIMIGSPILAAIYNKMGDRLPMPHKFAIGMVLC
SFAFLVLPVGTKFASDAGMVSVNWLILSYALQSIGELMISGLGLAMVAQLVPQRLMGFIM
GSWFLTTAGAAIIAGKVAGLMAVPENVTDPLLSLEVYGRVFMQIGIVTGVIAVLMLLTAP
KLNRMTLSEDKAEKANETATA
NT seq 1506 nt   +upstreamnt  +downstreamnt
gtgtcgactgcaaacaaagaaccagcagaaaacgtgagtcttaacgcgttcaagcaacct
aaatcgttctacctgattttctccatcgagctctgggagcgtttcggctattacggcctg
cagggcatcatggccgtttacctggtcaaaatgctgggcatgtccgaagcggactccatc
acgctgttctcctcctttagcgccctggtctatggcctggttgccattggcggctggctg
ggtgacaaagtacttggcacaaaacgcgtcatcatgctcggtaccgtggtactggctatc
ggttacgcccttgttgcctactccggccacgatgtaagcgtggtttatatcggtatggcc
accatcgcggtaggtaacggcctgttcaaggctaacccttcctcgctgctttctacctgc
tatgagaaagacgacccgcgtctggacggtgcattcaccatgtactacatgtccatcaac
atcggttccttcttctctatgctcgccaccccgtggctggctgcgcagtacggctggagc
accgcgttctccctgagcttcgtgggtatgctgattaccctcgtgaacttcatcttctgc
aaaaagtgggtgaagaactacggctccaaacctgacttcgcgccggtacacttcggtaag
ctgatggcgaccatcgccggcgtcgtggtgctggttgcggttgctacctggctgctgcac
aaccagggcattgctcgcgccgtactgggcgttgttgccctgggtatcgtccttatcttc
gctaaagaagcctttgcgatgaaaggcgcagctcgccgcaagatgatcgtggccttcatc
ctgatggttgaagctatcgtcttcttcgtgctgtacagccagatgccgacttccctgaac
ttcttcgctattcgtaacgtgggccatgaaattctcggcatcaccttcgaggcagagcag
ttccaggcgctgaacccgttctggatcatgattggtagcccgattctggccgcaatctac
aacaagatgggtgaccgcctgcctatgccgcacaagtttgctatcggtatggtgctgtgc
tccttcgccttcctggtgctgccggtcggcacgaagtttgccagcgacgcgggtatggtt
tccgtgaactggctgattctgagctacgcgctgcagagtatcggtgagctgatgatttcc
ggcctgggccttgccatggttgcacagctggtgccacagcgcctgatgggcttcattatg
ggtagctggttcctgaccaccgcaggtgcggccatcatcgccggtaaagttgctggcctg
atggcggtaccggaaaacgttaccgacccgctgctgtctctggaagtgtacggtcgtgtc
ttcatgcagattggtatcgtcaccggcgtgattgccgtgctgatgctgctgacagcgcct
aagctgaaccgcatgacgctgagtgaagacaaagcggaaaaggctaacgaaaccgctacg
gcgtaa

DBGET integrated database retrieval system