KEGG   Cedecea neteri SSMD04: JT31_03125Help
Entry
JT31_03125        CDS       T03298                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cnt  Cedecea neteri SSMD04
Pathway
cnt00480  Glutathione metabolism
cnt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    JT31_03125
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cnt02000]
    JT31_03125
Enzymes [BR:cnt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     JT31_03125
Transporters [BR:cnt02000]
 Other transporters
  Pores ion channels [TC:1]
   JT31_03125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_N_2 GST_C_2 GST_C_3 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: AIR03640
UniProt: A0A089RAN5
LinkDB All DBs
Position
692498..693100
Genome map
AA seq 200 aa AA seqDB search
MKLYFKPGACSLSPHIILRESGLDFSLVKVDLATKRTENGDDFLAINPKGQVPALVLDDG
SLLTEGVAIVQYLADKVPDRQLLAPAGSMTRYHTLEWLNYVATELHKGFSPLFNPATPEE
FKAVVRKQLEKKFQYVNEELKDKQWLMGSRFTVVDAYLFTVLRWAYGLKLDLAGLTNIEA
YVERMKARPAVSAALTAEGI
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtatttcaagcccggtgcctgttccctctccccgcacattatcctgcgtgag
tcaggtctggacttttcactggtaaaagttgacctggcgaccaaacgcaccgaaaacggt
gacgatttcctcgccattaacccgaaaggccaggtgcctgcgctggtgctggatgacggc
tctttgctgaccgagggcgtggctatcgtccagtatctggcagataaggttcccgaccgc
cagctgctggcaccggcgggcagcatgacccgctaccacacgctggagtggctgaactat
gtggcgaccgagctgcataaaggcttttctccgctgttcaacccggctacgccagaagag
ttcaaggccgtggttcgcaaacagctggagaagaaattccagtacgtgaacgaagagctg
aaggacaaacagtggctgatgggctcgcgcttcacggtggtagatgcctacctgttcacc
gtgctgcgctgggcgtacggcctgaagctggatctggctggcctgacgaatatcgaagcc
tatgttgaacgcatgaaggcgcgcccggcagtttctgcggcgctgaccgccgaagggatt
taa

DBGET integrated database retrieval system