KEGG   Cedecea neteri SSMD04: JT31_03150
Entry
JT31_03150        CDS       T03298                                 

Gene name
anmK
Definition
(GenBank) anhydro-N-acetylmuramic acid kinase
  KO
K09001  anhydro-N-acetylmuramic acid kinase [EC:2.7.1.170]
Organism
cnt  Cedecea neteri SSMD04
Brite
KEGG Orthology (KO) [BR:cnt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    JT31_03150 (anmK)
Enzymes [BR:cnt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.170  anhydro-N-acetylmuramic acid kinase
     JT31_03150 (anmK)
SSDB
Motif
Pfam: AnmK FGGY_C
Other DBs
NCBI-ProteinID: AIR03645
UniProt: A0A089RAP0
LinkDB
Position
complement(696629..697753)
AA seq 374 aa
MKSGRYIGVMSGTSLDGIDVVLAAIDEHLVVQQASYSHPMPLAIKNAVLAVCQGQQLTLS
QFGQLDNRLGKLFAEAVQILVKREGLRPEDVTAIGCHGQTVWHEPHGEAAHTLQIGDNNQ
IAALTGITVVGDFRRRDMALGGQGAPLVPAFHQALLAHPVERRMVLNIGGIANLSLLIPD
QPVRGYDTGPGNMLMDAWIWRQRGKGYDKDAEWASSGKVIIPLLQQMLSDPYFSAPAPKS
TGREYFNYGWLERQLARFPALAGEDVQATLTELTATTIAEQVLLSGGCERVMVCGGGSRN
PLLMARLAALLPGIEVTTTDEAGISGDDMEALAFAWLAYRTMSGLPGNLPSVTGASEPTI
LGAIYPANPRHNQS
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgaaatcaggtcgctatattggcgtgatgtcaggcaccagtctggatggcatcgatgtg
gtgctggccgctatcgacgaacacctggtcgtccagcaggcgagctacagtcacccgatg
ccgctggccatcaaaaacgccgttcttgccgtgtgtcaggggcagcagctcacgctgtcc
cagttcgggcaattggacaatcggcttggaaaattgttcgccgaggcggttcaaatcctg
gtaaaacgcgaagggctccggcctgaagacgtgacggccattggctgtcacgggcaaacc
gtctggcacgaaccgcacggcgaagctgcccacacgctgcagattggcgataataaccaa
atcgccgcgttgaccggcatcaccgtggtgggggatttccgccgtcgcgacatggcgctg
ggcgggcagggcgcgccgctggtgcccgcgttccatcaggcgctgctggctcatccggta
gaacgccggatggtgctcaatattggcggcattgccaacctctcgttgctgatccccgac
caaccggtcagaggttacgatacgggccctggcaacatgctgatggatgcctggatctgg
cggcagcgggggaaaggctacgataaagacgccgagtgggcgagcagcggaaaagtcatc
attccgttactgcagcagatgctcagcgacccttatttctctgcccccgcgcctaaaagc
accggacgtgaatactttaactatggctggcttgagcgccagctggccaggttccccgcg
cttgccggggaagatgtgcaggccacgctcactgaattgaccgccacaaccatcgccgag
caggtgttattgagcggcggctgtgagcgcgtaatggtgtgcggtggtggcagccgtaac
ccgctgctgatggcccgtcttgccgcgctgttgccgggaattgaagtcacgacaaccgac
gaggccgggatcagcggggacgatatggaagctctggcctttgcctggctggcgtatcgc
acgatgtccggcctgccggggaatcttccttcggtgaccggcgcctctgagccaacgata
cttggcgccatttatccggcaaatcctcgccataatcagagttaa

DBGET integrated database retrieval system