KEGG   Cedecea neteri SSMD04: JT31_03180
Entry
JT31_03180        CDS       T03298                                 

Definition
(GenBank) ABC transporter substrate-binding protein
  KO
K02030  polar amino acid transport system substrate-binding protein
Organism
cnt  Cedecea neteri SSMD04
Brite
KEGG Orthology (KO) [BR:cnt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cnt02000]
    JT31_03180
Transporters [BR:cnt02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter
    JT31_03180
SSDB
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd
Other DBs
NCBI-ProteinID: AIR03651
UniProt: A0A089PXG8
LinkDB
Position
complement(701662..702594)
AA seq 310 aa
MQKTSLLLAIALAWTPLAWANDVTINGTGVSLEANKAPVNTAKNPQAIAQLPKDYHFAVP
GKFTVAVAALNSPPLTVFSDDNKTLLGSEVDIARLVADSLGLELNVVPTSWEDWPLGVVS
GKYDAAISNITVTKDRKEKFDFATYRKDSLGFYVKANSPIKSISRAQEIAGLRVVVGSGT
NQEAILLAWNAENQKKGLKPFTPVYTKDDAALTLALQSGRADAWFGPNVTGAWKAALTGQ
TKLVGSVDGGWPKAAHIAVTLKKGSGLVEPVQTALNGAIQQGDYARVLNRWGEGVESIPA
SEINPAGLGD
NT seq 933 nt   +upstreamnt  +downstreamnt
atgcaaaaaacatcgctgttgctggccattgcgctggcatggaccccgcttgcctgggcg
aacgacgtcaccatcaacggaaccggcgtgagccttgaggcgaacaaagcgccggtaaat
accgctaaaaacccgcaggccatcgcgcagttacccaaagactaccattttgccgttccc
ggtaagtttaccgtggcagtggcggcgctgaactcgccgccgctgacggttttttctgat
gataataaaaccctgctcggcagcgaggtggatattgcacgcctggtggccgacagcctc
ggacttgagcttaacgtggtgcccacgtcctgggaagactggccgctgggcgtggtttcc
gggaaatatgatgccgcgatcagcaatattaccgtcaccaaagatcgcaaagagaagttc
gatttcgctacctatcgcaaagactccctgggcttttacgtcaaagccaacagcccgata
aaatccatcagccgtgcgcaagagattgccgggctgcgcgtcgtcgtgggttcaggcacc
aatcaggaagctatcctgctggcatggaacgctgaaaaccagaagaaaggcctgaagcct
tttaccccggtgtacaccaaagatgatgcggcactaacgcttgcactgcagtccggccgg
gcggatgcctggtttgggccaaacgtcaccggggcctggaaagcggcgctgaccgggcag
acgaagctggtgggcagcgtcgacggcggctggccgaaggctgcgcacattgcggtgacg
ctgaaaaaaggcagcggcctggttgagccagtacaaacggcgctcaacggcgctattcag
cagggcgactacgccagggtgctgaaccgctggggcgagggcgtggaaagtattcctgcc
tcggaaattaatcccgccggtttaggcgactga

DBGET integrated database retrieval system