KEGG   Cedecea neteri SSMD04: JT31_03285
Entry
JT31_03285        CDS       T03298                                 

Definition
(GenBank) endolysin
  KO
K03791  putative chitinase
Organism
cnt  Cedecea neteri SSMD04
Brite
KEGG Orthology (KO) [BR:cnt00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    JT31_03285
SSDB
Motif
Pfam: Glyco_hydro_19 Phage-MuB_C
Other DBs
NCBI-ProteinID: AIR03667
UniProt: A0A089PTI4
LinkDB
Position
732520..733152
AA seq 210 aa
MQLLGYEAAAGLTDAPALRWHAPVLQAMQEWHIAQPEDQAMFIAQIGHESGGFRTLRESF
KYSSRGLDIFVQAGRLTAEEALRLGRHPDEKVLPEVRQRAIAGRVYGGRMGNEGPDDGWN
YRGRGLIQITGRSNYRDCGFALGEDLVRFPERLESDTGAARSAAWFFASRGCLKHTGNLL
KVTRIINGGSHGLAGRQSRYTLALAAFKAI
NT seq 633 nt   +upstreamnt  +downstreamnt
gtgcagctgctgggctatgaagcggccgccgggctgacagacgccccggcgttacgctgg
cacgcccctgtccttcaggctatgcaggaatggcatatcgcgcagccagaggaccaggcg
atgttcatcgctcagatcggacatgagagcggcgggttcaggactctgcgggaaagtttt
aaatacagctcccgggggcttgatatttttgtccaggccggacgactgacggcggaggag
gccctgcgactggggcggcatccggacgaaaaggttctccctgaggtaagacagcgggcg
attgccggtcgggtctacggtggcaggatgggtaatgaaggccccgatgacggctggaac
taccgcggccgcggacttattcagataaccggacgcagcaactaccgggactgtggattt
gcgctgggtgaggacctggttcgctttccggaacgcctggagagtgacaccggggcagcc
cgctctgccgcatggtttttcgcctctcgcggttgcctgaagcatacgggcaacctactt
aaggtgacccgtattattaacggcggcagccacggcctggccgggcgccagagtcgctat
acgctggcgctcgccgcctttaaggcaatctga

DBGET integrated database retrieval system