KEGG   Cedecea neteri SSMD04: JT31_03420
Entry
JT31_03420        CDS       T03298                                 

Definition
(GenBank) cysteine desufuration protein SufE
  KO
K02426  cysteine desulfuration protein SufE
Organism
cnt  Cedecea neteri SSMD04
Brite
KEGG Orthology (KO) [BR:cnt00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    JT31_03420
SSDB
Motif
Pfam: SufE
Other DBs
NCBI-ProteinID: AIR03686
UniProt: A0A089PXK2
LinkDB
Position
complement(756233..756649)
AA seq 138 aa
MATLPDKEKLLKNFSRCANWEEKYLYIIELGSRLPELAADQHKPENIIQGCQSQVWIVMH
QQPDGVIMLEGDSDAAIVKGLIAIVFILYQQMTPQDIVAFDVRPWFEKMALAQHLTPSRS
QGLEAMIRSIRNKASTLS
NT seq 417 nt   +upstreamnt  +downstreamnt
atggccacgctgccggataaagaaaaactgctaaaaaacttcagccgctgtgcgaactgg
gaagagaagtatctctacattattgaactgggtagccgcctgccggaactggcggcggac
cagcacaagccggagaacattattcagggctgccagagtcaggtgtggatagtcatgcac
cagcagcctgacggggtgattatgctggaaggtgacagcgatgccgctattgttaagggg
cttatcgctatcgtgtttattctctatcagcagatgacgccgcaggatatcgtggccttt
gatgtgcgaccgtggtttgaaaaaatggcgctcgctcagcacctgacgccgtcccgttcc
caggggctggaagcgatgattcgctcaattcgcaacaaagcctccactctcagctaa

DBGET integrated database retrieval system