KEGG   Cedecea neteri SSMD04: JT31_03455
Entry
JT31_03455        CDS       T03298                                 

Definition
(GenBank) hypothetical protein
Organism
cnt  Cedecea neteri SSMD04
SSDB
Motif
Pfam: DUF4823 LPAM_1
Other DBs
NCBI-ProteinID: AIR03693
UniProt: A0A089PUK7
LinkDB
Position
complement(763860..764372)
AA seq 170 aa
MKRLLFVFAVVLLAGCSAKYSTNNVQKSTELLVKDLPVAVAKPTDGVYETHSYAGSGETT
ATVVKAAILRHSDSVSVYSDCEDLMCLKDKHTLSRGYYVVPQILHWEDRATQWSGIPDRI
EIKISVYNAETNARVASTIISGKSKWATFGGDHPQDLLPVPINAWITSLY
NT seq 513 nt   +upstreamnt  +downstreamnt
atgaaacggttgttgtttgtttttgctgttgtattacttgctggttgctccgctaaatac
agtaccaataatgttcaaaagagcactgagctgttagtcaaggatttacccgtcgcggta
gcaaaacctactgatggggtctatgaaacccacagctacgcagggtctggcgaaaccacc
gccacagtcgttaaagcagcaattttgcgccactccgatagcgttagcgtatattctgat
tgtgaagatctgatgtgtttaaaagacaagcatacgcttagccgtggttactatgtggtt
ccacagatccttcattgggaagacagggctacccagtggtccggtattccagacagaatc
gaaatcaaaatttctgtttataatgctgagaccaatgccagagttgcctcgaccattatt
agtgggaaaagcaagtgggccacatttggtggcgatcaccctcaggatcttttacctgtc
ccaattaatgcctggattacaagcctgtattaa

DBGET integrated database retrieval system