KEGG   Cedecea neteri SSMD04: JT31_03545
Entry
JT31_03545        CDS       T03298                                 

Definition
(GenBank) cyclic di-GMP regulator CdgR
Organism
cnt  Cedecea neteri SSMD04
SSDB
Motif
Pfam: EAL
Other DBs
NCBI-ProteinID: AIR03711
UniProt: A0A089PXM6
LinkDB
Position
complement(788334..789065)
AA seq 243 aa
MIVSLDSVYCSHLYYRPAVRPDDSIMGVEIVANFVGADAPVRIPTELLIPHLAPEQHLEL
FREKLTVIEAQQDFFITRQLVVWIHINETIIDALINNQNLYIRLKALPFIELTLSESFLD
LNSGKTNLRLAWAVERFPLVLADFGAGHATTKPVFDGLFRRVIMDRFFIQKLLSGRTFTP
FMLAIIGQVSPFCESLLVAGIDSANARRKVQALGFAAMQGKLWPLVQPEYLASLFPPHEG
LIH
NT seq 732 nt   +upstreamnt  +downstreamnt
atgattgtttcacttgatagtgtttattgttctcatctctattatcgtccggccgtacgg
ccggatgacagtattatgggtgtcgaaatcgtcgcaaacttcgtcggggctgacgcgcca
gtacgtattccaaccgagctgttaatccctcatcttgcccctgagcagcaccttgagctg
ttcagagaaaaattaacggtaatagaagcacagcaggatttctttatcacccggcagctt
gtggtctggattcatattaatgaaactattattgatgcgttaattaataaccagaattta
tatattcgcttaaaggctttgccgtttattgaattaaccctcagcgaaagttttttggat
ttaaatagcgggaaaactaatttaaggctggcctgggcagtggaacgttttccgctggtg
ctggcagactttggtgccggccatgccacgaccaaaccggtgttcgacggcctgttcagg
cgcgttattatggatcgtttttttattcaaaaactgctgtcgggccgcacctttacgcct
tttatgctggccatcattgggcaggtttccccgttttgtgaatcgttgctggtggccgga
atagactccgctaacgcgcggcgcaaagtgcaggcgctgggctttgccgcgatgcagggc
aaactgtggccgcttgttcagccggaatatctggcgtcactttttcctcctcatgaaggt
ctgattcactaa

DBGET integrated database retrieval system