KEGG   Cedecea neteri SSMD04: JT31_03550
Entry
JT31_03550        CDS       T03298                                 

Definition
(GenBank) LacI family transcriptional regulator
Organism
cnt  Cedecea neteri SSMD04
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_3 HTH_31 HTH_Crp_2 HTH_AraC HTH_23 PucR TetR_N Sigma70_r4 HTH_IclR YdaS_antitoxin HTH_17
Other DBs
NCBI-ProteinID: AIR03712
UniProt: A0A089PTM3
LinkDB
Position
complement(789233..790207)
AA seq 324 aa
MVTLEDVAAHAGVSRATVSRVVNGDTKVKAQTRIKVEAAIAELGYSPNPAARALASSQSH
SIGLVTTSYTGGFFGSLMDTVQTEAESNGKQLLVTQGRGVEENERNAIQRLYNLRCDGLI
LHVRAIADEALIQLAERGNRFIILDREVPALNARCVVFDHRLASHMATRYLLDAGHLAIA
CLHGPTQRTSSLLRRQGFLDAMEERDVTPVAVVEGEYDMPSGYRQTAMLLEKYKISALYC
CNEEMAVGAMLAITERGLRIPLDISLICYDSGDRAAFVRPALTSVYFPIGDMARYATRKL
LNEHCEDESFLPCIIARDSVRNLR
NT seq 975 nt   +upstreamnt  +downstreamnt
atggtcaccctcgaagatgttgctgcccacgccggcgtctcccgcgccaccgtctcacgc
gtggttaacggcgacactaaggtcaaagcgcaaacccgcatcaaggtagaagccgcgatt
gccgaactgggctattcccccaatcccgctgccagagcgctggcatccagccagagccat
tcgattgggctggtcacgacatcctataccgggggcttcttcggctcgctgatggatacg
gtgcaaaccgaagctgaatctaacggaaagcagctgctggtgacgcagggtcggggcgta
gaagagaacgagcgcaatgccattcagcggctctataacctacgctgcgacggtctgatc
ctgcacgtgcgtgcgatagccgatgaggcgctaattcagctggccgaacgcggcaacagg
tttatcatcctcgacagagaggtgcctgctttaaacgcgcgctgcgtggtcttcgatcac
cgtcttgccagccacatggccacccgctatttgctggatgccggccatctggcgatagcc
tgcctgcatggtccaacccagcgaacctccagccttttacgtcgtcagggttttcttgat
gccatggaggagagggatgttacgccggtggcggtggtagaaggcgaatacgatatgcca
agcggctaccggcaaaccgcgatgctgttagagaagtacaaaatcagcgcgctgtactgc
tgcaatgaagaaatggccgtcggggcaatgctggccattaccgaacgaggtttacgcatt
cctctggatatatcccttatttgttatgacagtggagatcgggcggcgtttgtacgcccg
gcgttaaccagcgtttattttccgataggggatatggcacgctacgcaacgcgtaaatta
cttaatgaacattgtgaggatgaatcttttttaccctgcatcattgcccgggactccgtg
cgcaatttgcgttaa

DBGET integrated database retrieval system