KEGG   Cedecea neteri SSMD04: JT31_03605
Entry
JT31_03605        CDS       T03298                                 

Definition
(GenBank) translation initiation factor IF-3
  KO
K02520  translation initiation factor IF-3
Organism
cnt  Cedecea neteri SSMD04
Brite
KEGG Orthology (KO) [BR:cnt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cnt03012]
    JT31_03605
   03029 Mitochondrial biogenesis [BR:cnt03029]
    JT31_03605
Translation factors [BR:cnt03012]
 Eukaryotic type
  Initiation factors
   MTIFs
    JT31_03605
 Prokaryotic type
   JT31_03605
Mitochondrial biogenesis [BR:cnt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    JT31_03605
SSDB
Motif
Pfam: IF3_C IF3_N DUF2303
Other DBs
NCBI-ProteinID: AIR03723
UniProt: A0A089PUN9
LinkDB
Position
complement(799178..799621)
AA seq 147 aa
MGIVSLNEALEKAEEAGVDLVEISPNAEPPVCRIMDYGKFLYEKSKSSKEQKKKQKVIQV
KEIKFRPGTDDGDYQVKLRSLVRFLEEGDKAKITLRFRGREMAHQQIGMEVLNRVRDDLS
ELAVVESFPTKIEGRQMIMVLAPKKKQ
NT seq 444 nt   +upstreamnt  +downstreamnt
attggtattgtcagtctgaatgaagctttggaaaaagccgaagaggccggggttgattta
gtagaaatcagtccaaacgccgaaccgcctgtttgccgcatcatggactacggcaagttc
ctctacgagaaaagcaaatcttctaaggaacagaagaaaaagcaaaaagttattcaggtt
aaggaaattaaattccgacctggcaccgatgatggcgactaccaggtaaaactccgcagc
ctggttcgctttctggaagagggagataaagctaagatcacgctgcgtttccgcggtcgt
gagatggctcaccaacagattggtatggaagtgcttaaccgcgtccgtgacgatctgagt
gaactggcagtggtcgaatccttccctacgaagatcgaaggccgccagatgatcatggtg
cttgctccgaagaagaaacagtaa

DBGET integrated database retrieval system