KEGG   Cedecea neteri SSMD04: JT31_03685
Entry
JT31_03685        CDS       T03298                                 

Definition
(GenBank) nucleotide excision repair endonuclease
  KO
K05984  excinuclease Cho [EC:3.1.25.-]
Organism
cnt  Cedecea neteri SSMD04
Brite
KEGG Orthology (KO) [BR:cnt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cnt03400]
    JT31_03685
Enzymes [BR:cnt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.25  Site-specific endodeoxyribonucleases that are specific for altered bases
    3.1.25.-  
     JT31_03685
DNA repair and recombination proteins [BR:cnt03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     JT31_03685
SSDB
Motif
Pfam: GIY-YIG
Other DBs
NCBI-ProteinID: AIR03738
UniProt: A0A089PUQ5
LinkDB
Position
812154..813017
AA seq 287 aa
MVRRAGASRLEFEAAAVYEYPEHLRPWLEGLPKAPGVYVFHGESDVMPLYIGKSVNIRTR
VMSHFRTPDEAALLRQSRRITFIRTAGELGALLLEAQMIKEQQPLFNKRLRRNRQLCSLL
LQGETPQVVYAKDVDFSSQPGLYGLYANRRAALQTLQGLADEHRLCYGLLGLESLSRGRA
CFRSALKRCAGACCGKETQAEHHARLVAALEQVRLICWPWKNAVVIVERSPEITQYHLID
HWFYLGSVPRLEDARQRRQPPDGFDNDGYKILCKLMLSGEYEVIELE
NT seq 864 nt   +upstreamnt  +downstreamnt
gtggtaaggcgtgcaggcgcgtcgcggctggagtttgaagctgcggcagtctatgaatat
ccggaacatctccgaccgtggctcgaagggctgcccaaagcgcctggcgtctacgttttt
cacggtgaaagcgacgtcatgccgctgtatatcggcaaaagcgtcaatattcgcacgcgc
gtcatgtcccattttcgtacgcctgatgaagccgcgctcttaaggcagtcccgccgtatt
acgtttatccgcacagccggagagcttggtgcattgctgctcgaggcgcaaatgatcaag
gagcagcagccgctgttcaacaagcgcctgcgccgcaaccgccagctttgttccctgcta
ctgcagggtgaaacgccgcaggtggtgtacgccaaagatgtcgatttctcaagccagccc
ggtctctacgggctgtatgccaatcgccgggccgcgctgcaaacgctgcaggggctggca
gacgaacaccgactctgctacggcctgctgggcctggagtctctgagcaggggccgggcc
tgttttcgctcggcgctaaaacgctgcgccggggcctgctgcggcaaagaaacgcaggcc
gagcatcacgcccgccttgtcgccgcactcgaacaagtacgcctgatttgctggccgtgg
aaaaacgcggttgtcatcgtggagcgcagcccggagataacccagtaccatctgatcgat
cactggttttatcttggatccgtgccgcggctggaggatgcccggcagcgccgccagccg
ccggacggctttgataacgatggctacaaaattctctgtaagctgatgctgagcggggaa
tatgaagtgattgagctggaatag

DBGET integrated database retrieval system