KEGG   Cedecea neteri SSMD04: JT31_05880Help
Entry
JT31_05880        CDS       T03298                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cnt  Cedecea neteri SSMD04
Pathway
cnt00010  Glycolysis / Gluconeogenesis
cnt00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cnt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JT31_05880
   00500 Starch and sucrose metabolism
    JT31_05880
Enzymes [BR:cnt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     JT31_05880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase DUF4038
Motif
Other DBs
NCBI-ProteinID: AIR04162
UniProt: A0A089PUY3
LinkDB All DBs
Position
complement(1272175..1273569)
Genome map
AA seq 464 aa AA seqDB search
MTAFPKTFLWGGAIAANQVEGAWQEDGKGISTSDVMQQGVFGAQKERVPGDSGIKDIAID
FYHRYPQDVALFAEMGFSCLRISIAWTRIFPQGDELEPNEAGLAFYDKLFDELAQHGIQP
MVTLSHYEMPWGLVKQYGGWGNRKVIDCFERYARCVFSRYQHKVKLWLTFNEINMSLHAP
LTGVGLEGEPEKGAVYQAIHHQLVASSLAVKACHEIIPDAKIGNMLLGGLMYPLTCKPDD
VLETLQENRSWLFFGDVQCRGCYPGYMLRYFRDNGIQLEISENDREILKNTVDFISFSYY
MTGCVTADEELNAKARGNILSMVPNPHLASSEWGWQIDPVGLRILLNTLWDRYQKPLFIV
ENGLGAKDKPEADGTINDDYRISYLNDHLVQVGEAIEDGVEMLGYTSWGPIDLVSASKAE
LSKRYGFIYVDRDDQGNGSLARSRKKSFHWYKEVIATNGGSLKR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgacagcatttccgaagacatttctgtggggcggcgctattgccgccaatcaggtcgaa
ggcgcgtggcaggaggacgggaagggcatttctacctcggacgtcatgcagcagggggtt
tttggcgcgcagaaggagcgcgtgccgggggatagcgggatcaaagacatcgccatcgat
ttctaccatcgttacccgcaggatgttgcgctgtttgccgaaatggggttcagctgcctg
cgaatttctatcgcctggacgcgtatcttcccgcagggcgacgagcttgagccgaacgag
gccgggctggcgttttacgacaagctgtttgatgagctggcgcagcacggcattcagccg
atggtgaccttgtcccactacgaaatgccgtggggcctggttaagcaatacggcggctgg
ggcaatcgcaaagttattgactgcttcgaacgctatgcgcgctgcgttttcagccgctat
cagcacaaggtaaagctgtggctgacgttcaatgagatcaacatgtcgctgcacgcgccg
ctgaccggcgttgggcttgaaggcgagccggagaaaggcgcagtttaccaggctattcat
caccagctggttgccagcagcctggcggttaaggcctgccatgaaatcattcctgacgca
aaaattggcaatatgctgctgggtggcctgatgtacccgctcacctgcaagccagacgac
gtgctggaaacgctgcaggaaaaccgtagctggttatttttcggcgacgttcagtgccgg
ggctgctatccgggctatatgctgcgctatttccgtgataacggcattcagcttgaaatc
agcgagaacgatcgtgagatcctgaaaaataccgtcgattttatctcgtttagctactac
atgaccggctgcgtcacggcggatgaagagcttaacgcaaaggcgcgaggcaacattctc
agcatggtgccgaacccgcatctggcaagctccgagtggggctggcagattgatccggta
gggctacgcattttgctcaacacgctgtgggatcgctatcagaagccgctgtttatcgtt
gaaaacggcctgggggcgaaagacaaacccgaagccgacggtacgatcaacgatgactat
cgcatcagctatctgaacgaccatctggtgcaggtgggcgaggcaattgaggacggtgta
gaaatgctgggttacaccagctgggggcctatcgacctggtcagcgcctcgaaggccgag
ctgtcgaagcgctacgggtttatctatgtggaccgtgatgaccagggaaatggctcgctg
gcgcgttcaagaaagaaaagcttccactggtacaaagaggttattgccaccaacggcggc
agcctcaagcgctaa

DBGET integrated database retrieval system