KEGG   Cedecea neteri SSMD04: JT31_13645Help
Entry
JT31_13645        CDS       T03298                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
cnt  Cedecea neteri SSMD04
Pathway
cnt00250  Alanine, aspartate and glutamate metabolism
cnt00410  beta-Alanine metabolism
cnt00640  Propanoate metabolism
cnt00650  Butanoate metabolism
cnt01100  Metabolic pathways
cnt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cnt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    JT31_13645
   00650 Butanoate metabolism
    JT31_13645
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    JT31_13645
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    JT31_13645
Enzymes [BR:cnt01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     JT31_13645
Amino acid related enzymes [BR:cnt01007]
 Aminotransferase (transaminase)
  Class III
   JT31_13645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AIR05618
UniProt: A0A089PZX7
LinkDB All DBs
Position
2904069..2905334
Genome map
AA seq 421 aa AA seqDB search
MKSAELNQRRLQATPRGVGVMCSYFAEKAENATLWDVEGNEVIDFAAGIAVLNTGHRHPK
VIAAVEKQLQAFTHTAYQIVPYESYVSLAERINDLAPIDGPAKTAFFTTGAEAVENAVKI
ARAYTKRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHAVYPNAAHGVTTE
DALKSLDRIFKADIAADQVAAIVLEPIQGEGGFNVAPPEFMQALRKLCDTHGILLIADEV
QTGFARTGKLFAMDYYDVKADLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIKEEQLCKRANQLGEHLKEVLNQARQGCPAIVDVRGQGSMVAVEFND
PQTGKPSPEFTREVQLKAQEQGLLLLSCGVYGNVIRFLYPLTIPDAQFTKALAILSQVLK
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagtgcagagctgaatcagcgtcgtttacaggccacgccgcgcggcgtgggcgtg
atgtgtagctactttgcagagaaggctgagaacgccaccctgtgggatgtggaaggcaat
gaagttattgattttgccgccgggattgcggtgctgaacaccggtcatcgtcatccgaaa
gtgattgccgccgtggagaaacagctacaggcctttacccacacggcttaccagattgtc
ccttatgaaagctatgtatcgctggccgagcgcattaacgatctggcacctatcgacggc
ccggcgaaaaccgcgttcttcaccaccggtgcagaagccgttgagaatgctgtaaaaatt
gctcgtgcctacaccaaacgtcccggcctgattacctttggcggcggcttccatggccgt
acctttatgaccatggcgctgaccggcaaagtggcgccttacaaaatcggtttcggccca
ttcccaggctccgtttaccacgcggtttaccccaatgccgcgcacggcgtaacgactgag
gatgcgctgaaaagtctcgaccgtatctttaaagcggatatcgccgccgatcaggttgcg
gccattgtgctggagccgattcagggcgaaggcggcttcaacgttgccccacctgaattt
atgcaggcgctgcgcaagctgtgcgatacccacggcattctgctgattgccgatgaagta
cagaccggcttcgcgcgcaccggcaagctgttcgccatggattattacgacgttaaggcc
gacctgatgacgatggcgaaaagcctggccggtggtttcccgctgtccggcgttgtgggt
cgcgctgaagtgatggatgcacctgcgcctggtggcctgggcggcacttatgcaggtaac
ccgctggcggttgctgcggctcatgctgtgctggacgtgattaaagaagagcagctgtgc
aagcgtgcaaaccagcttggcgaacacctgaaagaggtgctgaaccaggctcgccaaggc
tgcccggccattgttgacgtacgcgggcaaggctcgatggtggcggtggagtttaacgat
ccgcagaccgggaaaccttcgccggaatttacccgcgaagttcagctgaaggctcaggaa
caagggctgctgctgctgagctgcggcgtctacggtaacgttatccgcttcctttatcct
ctgaccattcctgatgctcagttcaccaaagcgctggccattctgtcccaggtgctgaag
ggctaa

DBGET integrated database retrieval system