KEGG   Cedecea neteri SSMD04: JT31_18400Help
Entry
JT31_18400        CDS       T03298                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cnt  Cedecea neteri SSMD04
Brite
KEGG Orthology (KO) [BR:cnt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    JT31_18400
Enzymes [BR:cnt01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     JT31_18400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 FAD_oxidored DAO FAD_binding_3 Thi4 K_oxygenase NAD_binding_8 AlaDh_PNT_C Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: AIR06511
UniProt: A0A089Q5G5
LinkDB All DBs
Position
complement(3905578..3907146)
Genome map
AA seq 522 aa AA seqDB search
MLDTTMKTQLKAYLERLTKPVELIATLDDGAKSSEVKELLAEIAELSDKVSFTINNDLPV
RKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLALLQVGGHPSKESQDLLAQIREIDGDFH
FETYYSLSCHNCPDVVQALNLMSVLNPRITHTAIDGGVYQNEIQERNVMGVPAVYLNGKE
FGQGRMTLAEIVGKIDTGAEKRAAQALNQREAYDVLIVGSGPAGAAAAVYAARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVDDYDVDVIDTQSASKLIPAKTEG
GLHQIQTASGATLKARSIIVATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQNKVRSLKNVDIVLNAQTLEVKGD
GSKVTGLQYKDRVTESVHDVALAGIFVQIGLLPNTTWLEGSVERNRMGEIIIDAKCETTV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTSAPE
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaacaatgaaaacccagctcaaagcctatcttgagagactaacgaaacct
gttgagttgattgccacgctggacgacggcgcgaaatcatctgaagtaaaagaactgctg
gcagaaatagctgagttatctgacaaagtttcattcaccattaataacgacctgccggtg
cgcaagccgtcgtttttaatcactaacccaggctcaaaccagggcccgcgctttgccggc
tctccgctgggtcacgaattcacttccctggtgctggccttgctccaggtcggcggtcat
ccgtccaaagagtctcaggatctgctggcgcaaatccgtgagatcgacggcgacttccac
tttgaaacctattattccctctcctgccacaactgcccggacgttgtgcaggcgctgaac
ctgatgagcgtgctgaacccgcgcatcacccacaccgctatcgacggcggcgtttaccag
aatgaaattcaggaacgcaacgtgatgggcgtgcctgccgtgtaccttaacggcaaagag
tttggccagggccgcatgacgttggctgaaatcgtgggcaaaattgacaccggcgcagaa
aaacgtgcggcacaagcgttgaaccagcgtgaagcttacgacgtactgatcgtcggcagc
ggccctgcgggcgcggcggcggcggtgtatgcggcgcgtaaaggcatccgtaccggcctg
atgggcgaacgcttcggcggccaggtgctggataccgtggatatcgaaaactacatttcc
gtgccaaaaaccgaaggccagaagctggcgggcgcgctgaaagcccacgtggacgactac
gacgtggacgtgatcgacacccaaagcgccagcaagctgatcccggccaaaaccgaaggc
ggcctgcatcagattcaaactgcgtccggcgcaaccctgaaagcgcgcagtattatcgtg
gccaccggcgccaaatggcgcaacatgaacgtgccgggcgaagatcagtaccgcaccaaa
ggcgtgacctactgcccgcactgcgacggcccgctgtttaaaggcaagcgcgtggcggtg
atcggcggcgggaactccggcgtggaagcggctattgacctggcgggtatcgttgagcac
gtcaccctgctggaatttgcccctgaaatgaaggccgaccaggtactgcagaacaaagtt
cgcagcctgaaaaacgtcgacatcgtgctgaacgcccagacgctggaagtgaaaggcgac
ggcagcaaagtgaccggcctgcagtacaaagaccgcgtgaccgaaagcgtgcatgacgtt
gccctggccggcatcttcgtgcaaatcggcctgctgccgaacaccacctggctggaaggc
agcgtggagcgcaaccgcatgggtgaaatcatcatcgacgcgaaatgcgaaaccaccgtc
aaaggcgtattcgccgcgggcgactgcaccaccgtgccttacaaacagatcatcatcgcg
acgggcgaaggcgcgaaagcttccctgagcgcgtttgattacctgattcgcacctcagcc
ccagaataa

DBGET integrated database retrieval system