KEGG   Corynebacterium sp. ATCC 6931: DR71_1339Help
Entry
DR71_1339         CDS       T03283                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase/fumarate reductase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
coa  Corynebacterium sp. ATCC 6931
Pathway
coa00020  Citrate cycle (TCA cycle)
coa00190  Oxidative phosphorylation
coa00650  Butanoate metabolism
coa01100  Metabolic pathways
coa01110  Biosynthesis of secondary metabolites
coa01120  Microbial metabolism in diverse environments
coa01130  Biosynthesis of antibiotics
coa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:coa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DR71_1339 (sdhA)
   00650 Butanoate metabolism
    DR71_1339 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DR71_1339 (sdhA)
Enzymes [BR:coa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DR71_1339 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     DR71_1339 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA NAD_binding_8 AlaDh_PNT_C Pyr_redox HI0933_like
Motif
Other DBs
NCBI-ProteinID: AIN82136
UniProt: A0A088QWI3
LinkDB All DBs
Position
1525022..1527040
Genome map
AA seq 672 aa AA seqDB search
MTNTEATVAADFRAPESVVDGVKIGKVLSDNSPGDKVSMKDHWQYQKDHANLVSPLNRRK
FRVMVVGTGLAGGAAAAALGELGYDVQVFTYHDAPRRAHSIAAQGGVNSARGKKVDNDGA
YRHVKDTVKGGDYRCRENDCWRLAVESVRVIDHLNAIGAPFAREYGGTLATRSFGGVQVS
RTYYTRGQTGQQLQLSTTSALQRQIGLGNVEIFTHNELVDIIVADGRCQGAIMRNLINGE
LTVHTAHAVILATGGYGNVYHMSTLAKNSNASAIMRAYDQGAYFASPSFIQFHPTGLPVN
AHWQSKTILMSESLRNDARIWTPKKKGDERPANDIPEDERDYFLERRYPAFGNLVPRDVA
SRANSQQINAGYGVGPLKNSVYLDLRDAIERLGQPVIKERYSNLIQMYEEAIGEDPYKVP
MRIAPTCHFTMGGLWSDFNQMTSIPGLFTGGEASWTYHGANRLGANSLLSGSVDGWFTLP
FTIPNYLGPLLGTDRLAEDAPEAKEALDRAQARLDKLMSIQGKHGAEYFHRQLGEILYRD
CGVARNKEDLARGIEEIRELRKAFWSDLFIPGEPNEMNQQLEYANRVADYIDLGELMCVD
ALDRDESCGAHYRDDHISEDGEAERDDANWCFVSAWERGNNGPAWDQSGHEFIRHAEPLT
FEAVPLMTRNYK
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgactaacactgaagcaaccgtcgctgcggacttccgcgcgccggaaagcgttgtcgac
ggggtcaagatcggcaaggttctgtccgataactccccgggtgacaaggtctccatgaag
gaccactggcagtaccagaaggatcacgccaacctggtttcgccgctgaaccgtcgtaag
ttccgcgtcatggtcgtcggtaccggcctggctggtggcgctgccgctgctgccctcggt
gagctcggttacgacgtgcaggttttcacctaccacgacgctccgcgccgtgcgcactcc
attgctgcacagggtggtgtcaactccgctcgcggtaagaaggtcgacaacgacggcgct
taccgccacgtcaaggacaccgttaagggcggcgactaccgctgccgcgagaacgactgc
tggcgtctggctgtcgagtccgtccgcgtcatcgaccacctgaatgcaattggtgctccg
ttcgctcgcgagtacggcggtaccctggcaacccgttccttcggtggtgtgcaggtctcc
cgtacgtactacactcgtggtcagacgggtcagcagctgcagctgtcgactacctcggct
ctgcagcgccagattggtctcggcaacgtcgagatcttcacccacaacgagctggttgac
atcatcgtcgccgacggccgttgccagggtgccatcatgcgtaacctcatcaatggtgag
ctgaccgttcacactgctcacgcagttattctggctaccggcggttacggcaacgtctac
cacatgtccacgctggccaagaactccaacgcttcggccatcatgcgtgcatacgaccag
ggtgcttacttcgcatccccgtccttcatccagttccacccgaccggtcttccggtcaac
gcgcactggcagtcgaagaccattctgatgtccgaatccctgcgtaacgacgcacgtatt
tggaccccgaagaagaagggcgacgagcgcccggccaacgacatcccggaggacgagcgc
gactacttcctggagcgtcgctacccggcattcggtaacctcgtcccgcgtgacgtcgct
tcccgtgccaactctcagcagattaacgccggctacggtgttggtccgctgaagaactcc
gtctacctggatctgcgtgacgcaattgagcgcctgggccagccggtcatcaaggaacgc
tactcgaacctgattcagatgtacgaagaggcaatcggtgaggacccgtacaaggttccg
atgcgcattgctccgacctgccacttcaccatgggtggtctgtggtctgacttcaaccag
atgacctccatcccgggtctgttcaccggtggcgaggcatcctggacctaccacggtgca
aaccgcctgggtgcaaactccctgctgtccggttcggtcgacggttggttcaccctgccg
ttcaccattccgaactaccttggcccgctgctcggtaccgaccgcctggctgaggatgcc
ccggaggccaaggaagcactggaccgcgctcaggctcgcctggacaagctgatgagcatc
cagggtaagcacggcgctgagtacttccaccgccagctcggtgagattctctaccgcgac
tgtggtgtggcccgtaacaaggaagacctggctcgtggtatcgaggagatccgcgaactg
cgtaaggcattctggtctgacctgttcatcccgggtgagccgaatgagatgaaccagcag
ctcgagtacgctaaccgtgttgctgactacatcgacctcggtgagctcatgtgtgtcgac
gccctcgaccgcgatgagtcctgcggtgctcactaccgcgatgaccacatctccgaagat
ggcgaggcagagcgcgatgacgctaactggtgcttcgtttccgcatgggagcgaggcaac
aatggtcctgcatgggatcagtccggtcacgaattcattcgccacgccgagccgctcacc
ttcgaagccgtcccgctcatgacaaggaactacaagtaa

DBGET integrated database retrieval system