KEGG   Corynebacterium sp. ATCC 6931: DR71_1340Help
Entry
DR71_1340         CDS       T03283                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur family protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
coa  Corynebacterium sp. ATCC 6931
Pathway
coa00020  Citrate cycle (TCA cycle)
coa00190  Oxidative phosphorylation
coa00650  Butanoate metabolism
coa01100  Metabolic pathways
coa01110  Biosynthesis of secondary metabolites
coa01120  Microbial metabolism in diverse environments
coa01130  Biosynthesis of antibiotics
coa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:coa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DR71_1340
   00650 Butanoate metabolism
    DR71_1340
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DR71_1340
Enzymes [BR:coa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DR71_1340
    1.3.5.4  fumarate reductase (quinol)
     DR71_1340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_7 Fer4_10 Fer4_8 Fer4_9 Fer4_17 Fer4 Fer4_15 Fer4_18 Fer4_2 Fer4_4 Fer4_6 Fer4_21 Fer4_16 Fer4_3 Fer2 Fer4_22 Fer4_13
Motif
Other DBs
NCBI-ProteinID: AIN81537
UniProt: A0A088QDT9
LinkDB All DBs
Position
1527040..1527789
Genome map
AA seq 249 aa AA seqDB search
MKLHLEIWRQAGPNVEGHFESVDVDDAVAEMSILELLDHVNSKYVESGKEPFAFASDCRE
GICGTCGLNVNGRPHGPGQNTPTCQQRLHQFSDGDTLKIEPMRSAAYPVIKDMVVDRSAL
DRVLEQGGYVSINAGTAPDADTLHLNHETAEFALDHAACIGCGACVAACPNGAAHLFTGA
KLVHLSLVPLGKEERGKRARKMVDEVEGTFGPCSLYGECADVCPAGIPLTAVAAVTKERA
RSFFRGKDD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcaccttgaaatctggcgccaagcaggtccgaacgtcgagggacactttgaa
tccgttgacgttgacgacgccgtcgcagagatgtcgatcctggagctgcttgaccacgtc
aactccaagtacgtcgagtccggcaaggagccgttcgcgttcgcatctgactgccgtgag
ggtatctgtggtacctgtggtctgaacgtcaacggtcgtccgcacggcccgggccagaac
accccgacctgtcagcagcgcctgcaccagttcagcgatggtgacaccctgaagatcgag
ccgatgcgctccgccgcatacccggtcatcaaggacatggtcgttgaccgctccgctctg
gaccgtgtcctcgagcagggtggctacgtctccatcaacgctggtaccgctccggatgca
gatactctgcacctgaaccacgagaccgctgagttcgcacttgaccacgcagcctgcatc
ggctgtggtgcttgtgtcgcagcttgcccgaacggtgctgcacacctgttcaccggcgca
aagctggttcacctttccctggtcccgctgggtaaggaagagcgtggcaagcgtgcccgc
aagatggttgacgaggtcgaaggcaccttcggtccgtgctccctctatggtgaatgtgct
gacgtctgcccggcaggtatcccgctgactgcggttgccgccgtcaccaaggaacgagct
cgttcgttcttccgcggtaaggacgactag

DBGET integrated database retrieval system