KEGG   Corynebacterium sp. ATCC 6931: DR71_239Help
Entry
DR71_239          CDS       T03283                                 

Gene name
hisB
Definition
(GenBank) imidazoleglycerol-phosphate dehydratase
  KO
K01693  imidazoleglycerol-phosphate dehydratase [EC:4.2.1.19]
Organism
coa  Corynebacterium sp. ATCC 6931
Pathway
coa00340  Histidine metabolism
coa01100  Metabolic pathways
coa01110  Biosynthesis of secondary metabolites
coa01230  Biosynthesis of amino acids
Module
coa_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:coa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    DR71_239 (hisB)
Enzymes [BR:coa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.19  imidazoleglycerol-phosphate dehydratase
     DR71_239 (hisB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPD Fae
Motif
Other DBs
NCBI-ProteinID: AIN82477
UniProt: A0A088QGB7
LinkDB All DBs
Position
complement(277508..278146)
Genome map
AA seq 212 aa AA seqDB search
MHFSDKDHLEAERTERVGRIERATRESSIVCSVNLDGTGKTDISTGLPFFDHMLTAFGSH
GSFDLTVHANGDTEVDAHHTVEDTGIVMGQAFAQALGDKSGIRRFGDSFIPMDETLTHAV
VDVSGRPYFVGTGEPEQMLTAVIGGHYATVINEHFFESFALNARIALHVRCLYGRDPHHI
TEAEYKAVARALRAAVEDDPRVHGVPSTKGTL
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgcacttcagtgataaggaccatctggaggcagagcgcactgagcgcgttggccggatc
gagcgcgccacccgtgaatcgagcatcgtctgctcggtgaatctcgatggcaccggcaag
accgatatttcgacaggtctgccgttctttgaccacatgttgaccgctttcggctcccac
ggcagcttcgacctgactgtgcatgccaacggtgacaccgaggtcgatgcgcaccacacg
gtggaggacaccggcatcgttatggggcaggcgtttgcccaggcactgggggataagtcc
ggtattcgccgctttggtgacagcttcattccaatggatgaaactctgacgcacgcagtg
gttgacgtgtcgggtcgtccgtattttgttggtactggcgagccagagcagatgttgact
gccgttattggtggccattacgcaacggttatcaatgagcacttctttgagtccttcgcc
ctaaatgctcgcattgcgctgcatgttcgctgtctctacgggcgcgatccgcaccacatc
accgaggctgagtacaaggctgtggcccgtgccctgcgtgctgccgtcgaggacgacccg
cgcgtccacggtgtgccgtcgactaagggcaccctatag

DBGET integrated database retrieval system