KEGG   Caldicellulosiruptor obsidiansis: COB47_1711Help
Entry
COB47_1711        CDS       T01293                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
cob00473  D-Alanine metabolism
cob01100  Metabolic pathways
cob01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cob00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    COB47_1711
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    COB47_1711
Enzymes [BR:cob01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     COB47_1711
Peptidoglycan biosynthesis and degradation proteins [BR:cob01011]
 Precursor biosynthesis
  Racemase
   COB47_1711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADL42990
UniProt: D9TFM0
LinkDB All DBs
Position
complement(1843388..1844560)
Genome map
AA seq 390 aa AA seqDB search
MTKLSLYNRVWAEINLDNLLYNLENIKKKILPQTKIMAVVKADAYGHGAVEISRVLVKNG
VSMLAVAIIDEALQLRHFNFDVPILILGFTPFELSEQVVENEISQTVYTYEQAYYLSKAA
QKIGKKAKIHIKVDTGMGRIGFLCCEQSVNTILNIAKLPNIELEGIFSHFSSADDPDSDD
FTHEQFIKFENFVKELNKNGVYFKYKHIANSSAAIRFPQYQLDVVRLGLILYGLYPNSSL
KEHINLKPVMSVKARVINVKEVPEGFPISYNRRYITTRKSKIATIPIGYADGFTRVGSSQ
RHVLIKGEFAKVVGSICMDQCMVDVTDIEDVKIGDEVVIIGKQGKNEILADHLAEQIGTI
NYEVVCSFSKRIPRVFIKDGRVVKILNYIL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaattgtcgctctacaacagggtatgggcagaaataaatcttgacaatttactg
tacaaccttgaaaatatcaagaaaaagattttaccacaaacaaaaataatggccgttgtg
aaggctgatgcatatggacacggagcggttgaaatttcaagagtacttgtaaaaaatggt
gttagtatgctcgctgtggcaataattgacgaggcattgcagctgagacatttcaatttt
gatgttccaattttaattttgggttttactccttttgaactgtccgaacaggttgttgaa
aacgagataagccaaacagtttatacgtatgagcaggcatattatcttagcaaggcagcc
caaaaaataggtaaaaaagccaagatacatatcaaagttgatactggaatgggaagaata
ggatttttatgctgtgaacagagcgtaaacaccatattaaatattgctaagctgccaaac
atcgaacttgaggggatattctctcatttttcatctgcagacgacccagattcggatgat
tttacgcatgagcagtttataaaatttgaaaactttgtgaaagaactcaataaaaatggg
gtatactttaaatataagcacattgcaaatagcagtgcggcaatccgtttcccccagtat
caacttgatgttgtaagacttggtcttattctatacgggctttatccaaacagcagtttg
aaagaacatataaacttaaaacctgtaatgtctgtcaaagcaagagttatcaatgtaaag
gaggtgccagaaggcttcccaataagttacaacagaagatatataaccacacgcaaaagt
aaaatcgctacaatacctatcggttatgcagacggttttacgcgtgttggaagtagtcaa
aggcatgttctcataaaaggtgagtttgccaaagttgttgggagtatatgtatggaccag
tgcatggtagatgtgaccgatatcgaggatgtgaagattggtgatgaggttgtcattata
gggaaacaagggaaaaatgagattttggctgatcatttggctgagcagattggcactata
aactatgaggttgtgtgttcgtttagcaagcgaattccacgggtttttatcaaggatggg
cgagttgtcaaaatattaaactatatcttatga

DBGET integrated database retrieval system