KEGG   Caldicellulosiruptor obsidiansis: COB47_1845Help
Entry
COB47_1845        CDS       T01293                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
cob00040  Pentose and glucuronate interconversions
cob00051  Fructose and mannose metabolism
cob01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cob00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    COB47_1845
   00051 Fructose and mannose metabolism
    COB47_1845
Enzymes [BR:cob01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     COB47_1845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C TrkA_N PrmA UDPG_MGDP_dh_N Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ADL43120
UniProt: D9TG00
LinkDB All DBs
Position
complement(1987494..1988534)
Genome map
AA seq 346 aa AA seqDB search
MGTMKAIVLEKPKVLKMEIRDRPVIADDEVLVAVKCVGICGSDVHYYEHGKIGRYVVEKP
LILGHEASGEVVSVGKNVKKFNVGDKIVIEPGVTCGKCEYCKSGRYNLCPDVKFLATPPV
DGALCEYVAVREDYLFKVPNDVDYDIATLVEPLSVGIHGAMRGNVKVGDKVLILGLGPVG
LLTILAVKAFGASQVIAVDVQPLRLEAAKELGATHVINAKENNYKQLILEATGNTGPDIT
FETAGSKETNKTAFEITKRGGRIVLIGLLAESEVPVNINSVVDNEYNVYGVFRYANTYNK
AIEVLSCNLEKVKKLVTHRFKLDEAAQAFEFVRENKDKCIKAVIVI
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgggaacgatgaaggctattgtattagaaaaaccaaaagttttaaaaatggaaataagg
gatagacctgtgattgcggatgacgaagtattagttgctgtcaaatgtgtagggatttgt
ggttctgatgttcattattatgaacatgggaaaataggtagatatgttgtagaaaaacca
ttgattttaggtcatgaggcaagcggagaagttgtcagcgtagggaaaaatgtaaaaaaa
tttaatgttggagataaaatagtcatcgaacctggggtaacttgtgggaaatgtgaatat
tgtaagagtgggcgatataatctatgtcctgatgttaagtttttggctacaccgcctgtt
gatggagcactgtgtgaatatgtagctgtaagagaggattatttgtttaaggttcccaat
gatgttgattatgacatagcaactttggttgaaccactgtcagtaggtattcatggtgct
atgcggggaaacgtaaaagttggggacaaagtattgattttaggattaggtcctgtaggt
ttgttgaccattttagcagtaaaagcatttggagcaagtcaagtaatagcagtagatgtt
caacctttgaggttggaggcagcaaaggaattaggagcaactcatgtcataaatgcaaaa
gagaacaattataagcaattaatacttgaagcaactggaaatactggtccagatataact
tttgaaactgcaggttctaaagagacaaataaaacagcctttgaaataacaaaacgcggc
ggtagaatagtccttattggtttattggcagaaagtgaggttccagtaaatataaattct
gttgtagataacgagtataacgtttatggtgtttttagatatgcaaatacttataacaaa
gctattgaagttttgtcatgcaatttagaaaaagttaaaaaactagtaactcataggttt
aaattggatgaggctgcacaagcttttgaatttgtaagagaaaataaagataaatgtata
aaagcggtgattgtcatataa

DBGET integrated database retrieval system