KEGG   Capnocytophaga ochracea: Coch_1329Help
Entry
Coch_1329         CDS       T00961                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
coc  Capnocytophaga ochracea
Pathway
coc00240  Pyrimidine metabolism
coc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:coc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Coch_1329
Enzymes [BR:coc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Coch_1329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK UvrB_inter DUF777
Motif
Other DBs
NCBI-ProteinID: ACU92875
UniProt: C7M5R6
LinkDB All DBs
Position
complement(1544350..1544943)
Genome map
AA seq 197 aa AA seqDB search
MFLENTVNNNEKTGWIEVICGSMFSGKTEELIRRLRRAQFAKQKVEIFKPSFDTRYDDTN
IVSHNANEIPSTPVEAAASIMLLADGCDVVGIDEAQFFDDEIVHVCNELANRGVRVIVAG
LDMDYKGKPFGPMPFLMATAEYVTKVHAVCTRTGNLANYSFRKVSNDQQRLLGEADSYEP
LSRAAFYKAMNAKKTKE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtttttagagaatactgtaaataacaacgaaaagacaggctggatagaagtaatatgc
gggtcgatgttctcaggcaaaaccgaagaactgattcgccgattacgtcgtgcccaattt
gcaaaacagaaggtagagatttttaaacccagtttcgacacgcgttatgatgataccaac
atcgtatcgcacaacgccaatgaaattccttctacacccgtagaagccgccgccagcatt
atgcttcttgccgatggttgcgatgtggtgggtatagacgaagcacagtttttcgacgac
gagatagtacacgtgtgcaatgagctcgccaatcgcggggtacgtgtaatcgtagcagga
ctcgatatggactataaaggaaagcctttcggacctatgcccttcttgatggctactgcc
gagtatgttactaaggtacacgctgtttgtacgcgtactggcaacctcgctaattatagt
tttcgcaaagtgtctaacgaccagcaacgcttgttaggagaagccgatagctatgagcct
ctcagtcgcgctgccttctataaagcaatgaatgctaagaaaacaaaagaataa

DBGET integrated database retrieval system