KEGG   Corynebacterium pseudotuberculosis 1/06-A: Cp106_0805Help
Entry
Cp106_0805        CDS       T02052                                 

Gene name
marR1
Definition
(GenBank) Multiple antibiotic resistance protein marR
Organism
cod  Corynebacterium pseudotuberculosis 1/06-A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR_2 MarR HTH_27
Motif
Other DBs
NCBI-ProteinID: AER68884
LinkDB All DBs
Position
851669..852145
Genome map
AA seq 158 aa AA seqDB search
MTNPRWLNDEEQSLWRLMLAVNRKVSRGIDETLQLGSGLTSSEFAVLVNLSESPDHIIRL
RDLCVSLNWDRSRTSHQIIRMEKRGLVVKKRCPDDGRGVYVQLTREGEERLRSAAPGHVE
VVRKLVFDPMGPGHVATLRDYLEKVVAVDFDPDKYVGG
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacccgagatggctcaatgatgaagaacagtccctgtggcgtctgatgcttgcc
gtgaatcggaaagtgagcagagggattgatgagacactacaactagggtcggggctcacc
tcttcggagttcgcagttttggtgaatttatccgaaagtcctgatcatattattcggctt
cgtgatctctgcgtctctcttaactgggatcggagccgtacgtctcatcagatcataaga
atggaaaaacgtggtctagtggttaagaagcgatgcccggacgatggtcggggtgtttat
gttcagctgactcgagagggggaagaacgcttacgatctgctgcgcctggtcatgtggag
gtggttaggaaattggtttttgatcctatgggaccaggacatgtggcaaccctacgtgat
taccttgaaaaggtcgtggctgtcgattttgacccggataaatatgtgggtggataa

DBGET integrated database retrieval system