KEGG   Corynebacterium pseudotuberculosis 1/06-A: Cp106_0998Help
Entry
Cp106_0998        CDS       T02052                                 

Gene name
ppm1
Definition
(GenBank) Polyprenol-phosphate-mannose synthase domain 1
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
cod  Corynebacterium pseudotuberculosis 1/06-A
Pathway
cod01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cod00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cod01003]
    Cp106_0998 (ppm1)
Enzymes [BR:cod01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     Cp106_0998 (ppm1)
Glycosyltransferases [BR:cod01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   Cp106_0998 (ppm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3
Motif
Other DBs
NCBI-ProteinID: AER69068
LinkDB All DBs
Position
complement(1073629..1074426)
Genome map
AA seq 265 aa AA seqDB search
MTKPSDKTLVIIPTYNELENLPLITGRVREAAPNVDILIVDDNSPDGTGEAADALAEKDS
HIKVFHREGKGGLCGAYVAGFRWGLERDYTVLCEMDADGSHAPEQLHLLLEQVDAGADLV
IGSRYVPGGKVVNWPKNRWVLSKGGNIYISVALGAGLSDMTAGYRAFKREVLETIDLDEL
SNAGYIFQVDMAWRVVRAGFDVREVPITFTEREIGESKLDGSFVKDSLLEVTKWGLNHRK
EQLTNIYREGSKLAKHEIAAFRKSI
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcccagcgataagaccctggtgatcattcccacctacaatgagctggagaat
cttcccctcatcaccggtcgtgtccgtgaggccgctcctaacgtggacattctgattgtc
gatgacaacagccccgatggaaccggtgaagcagctgatgcattggcagaaaaagacagc
catatcaaggttttccatcgagaaggtaaaggcggtctatgtggcgcctatgttgctgga
ttccgctggggccttgagcgcgattacacggttttgtgtgaaatggatgcagatggttcg
catgcacctgagcaactgcacttgctgcttgagcaggtagacgcaggagccgatcttgtt
atcggttcccgttacgtcccaggcggcaaagtagtgaactggcctaaaaaccgttgggta
ttgtccaaaggtggcaacatctatatctctgttgccctcggcgctggtctctcggatatg
actgcaggctaccgagccttcaaacgcgaggttttagaaaccattgacctcgatgagcta
tccaatgcaggttatatcttccaagttgatatggcatggcgagtggtacgagctggattc
gatgttcgtgaagtaccaattacgttcacagagcgtgaaatcggagagtctaagctagac
ggcagctttgtcaaagactcgctcctcgaagtaactaagtgggggctaaaccaccgaaaa
gagcagctaaccaatatctaccgtgaaggttctaagctggcaaagcatgagatcgccgct
ttcaggaaaagcatatga

DBGET integrated database retrieval system