KEGG   Corynebacterium pseudotuberculosis 1/06-A: Cp106_1186Help
Entry
Cp106_1186        CDS       T02052                                 

Gene name
ppgK
Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cod  Corynebacterium pseudotuberculosis 1/06-A
Pathway
cod00010  Glycolysis / Gluconeogenesis
cod00520  Amino sugar and nucleotide sugar metabolism
cod01100  Metabolic pathways
cod01110  Biosynthesis of secondary metabolites
cod01120  Microbial metabolism in diverse environments
cod01130  Biosynthesis of antibiotics
cod01200  Carbon metabolism
Module
cod_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cod00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp106_1186 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    Cp106_1186 (ppgK)
Enzymes [BR:cod01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Cp106_1186 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AER69253
LinkDB All DBs
Position
1289775..1290551
Genome map
AA seq 258 aa AA seqDB search
MPFSKLKFMTRIGFGIDVGGSGIKGARVDLDTGDFVGDRIKILTPKPATPEAVAQTISRI
VAEAEWEGPVGITLPSVIRNQVALSAANIDQSWINVDVQKLFTKTLGGRNIAVLNDADAA
GIAEVAFGEDQARRGSAILLTLGTGIGSAFFINGVLFPNTELGHMIVEGKEAEPLASSAA
KDRDELSYSKWAKRVSKVLSEYERLFWPDVFIVGGGISRKADKWVPKLTIDTPVIPAKLR
NTAGIVGAAMAADQNIRP
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgccattcagtaagctcaagttcatgacacgaattggctttggcattgatgttggcgga
tctgggattaaaggtgcccgcgttgatctggataccggtgattttgtcggagatcggatc
aagattttaacccccaagcctgccacccccgaagcggtcgcccaaacgatttctcgcatt
gttgcagaggctgaatgggaaggacccgtcggaataacgctgccttccgtaatccggaat
caagtagcactttctgccgccaacattgaccaatcatggatcaatgttgatgttcaaaaa
ttatttaccaagaccctgggcgggcgtaacatcgcagtgcttaacgacgccgatgcggcg
ggcatcgccgaggtagccttcggagaagatcaagctcgacgtggttccgccattttgctc
actctaggcactgggatcggttccgctttctttatcaacggggtcttattccccaacacc
gagttagggcacatgatcgtagagggaaaggaagccgagcctctagcttcatctgcagca
aaagatcgcgatgagttgagctattccaaatgggccaagcgcgtttctaaagtcctcagc
gaatacgaacgacttttttggccagacgtttttatcgtaggcggtggtatctcacgcaaa
gctgataaatgggtacccaaactcactatcgatacgcccgtcatacctgcaaaactacgt
aataccgcaggtatcgtaggagcagcaatggcggcagaccaaaatatcaggccttag

DBGET integrated database retrieval system