KEGG   Corynebacterium pseudotuberculosis 258: CP258_09485Help
Entry
CP258_09485       CDS       T02118                                 

Definition
(GenBank) protein kinase
  KO
K14949  serine/threonine-protein kinase PknG [EC:2.7.11.1]
Organism
coe  Corynebacterium pseudotuberculosis 258
Brite
KEGG Orthology (KO) [BR:coe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:coe01001]
    CP258_09485
Enzymes [BR:coe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CP258_09485
Protein kinases [BR:coe01001]
 Serine/threonine kinases: Other
  Bacterial family
   CP258_09485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PknG_TPR Pkinase Pkinase_Tyr TPR_19 APH
Motif
Other DBs
NCBI-ProteinID: AFK17469
LinkDB All DBs
Position
2032361..2034610
Genome map
AA seq 749 aa AA seqDB search
MNDPLSRGTEAIPFDPFADDEEDDLSGLLNDLSSIQKDTDTDARSREKSISTFRSRRGTN
RDDRTVANGMVTLPFIPVSTAEEMLKDDAYIEQKGLEKPLLHPGDILANQYEVRGVIAHG
GMGWIYVASDRNVSGRVVVLKGMRDKANANPHDYGAAVAEREFLADITHPGIVKSYNFID
DHRVEGGFIVMEYVPGPSLADRRKEQPGGFFSIDIAIAYILEILPALDYLHSRGVVYNDL
KPDNIIVAEDQVKLIDLGAVSGIGAFGYIYGTKGFQAPEVATDGPSIASDIYTIGRTLAA
LTVDLPSADGVYLPGIPSPDEEKLFAQNLSFYRLLRRCMSSDPAKRFASIRELETQLFGI
LREYLALAEHRQFPAQHSLYSPQRSTFGTKHMVFRTDQLIDGIERNVRITSEEVNAALPV
PLLDRTDPGAILISGASYAEPSQTLQTLRDAMAQEEFANSKEIPLGVVRTLLDLGFIDEA
RSWLDTLDATLSDDWRHQWYSGVTSLFLDDYVMAQRHFNEVYNILPGEAAPKLARAAVCE
MLLQDMGMDSTPLLSPDTAVSAAELKGNTIGMWSELTKDPETLRFKALYLYALVWRTNPT
TVSSAFGLARQLVAENQVDLAVSTLDQVPQNSTHRRMAELTAILHLISGELSESRIRRAA
RRLESIPTNEPRFLQIKIAIMNAALTWLRQSRLEAAAADNDLFDYRFTQVGLRTGLYDSL
RLLARSAPNAHHRYTLVDMANQVRPMTWF
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaccctctaagtcgtggaaccgaggccatcccctttgatcctttcgcagacgat
gaagaggatgacctctcggggcttcttaatgatctcagcagtatccaaaaagacacggat
acagatgctcgttcacgggaaaagtcgatctccacatttcgctcccggcgcggcactaac
cgcgatgaccgcaccgtggctaacggcatggtcaccctgccttttatcccggtttccaca
gcggaagaaatgctcaaggacgatgcctatattgagcagaaaggcctagaaaagccgctt
cttcaccccggcgatatcctggccaatcagtatgaggtccggggcgtaatcgctcatggt
ggtatgggttggatctatgtggctagcgaccgcaatgtctctgggcgcgtcgtggtgctc
aaaggcatgcgcgataaggccaatgccaatcctcacgactacggcgcggccgtggcagaa
cgggaatttctagcagatattacgcacccgggaatcgtaaaatcctataacttcattgat
gaccaccgtgttgaaggcggctttattgtcatggagtacgtcccggggccgtcgctggca
gatcggcgcaaagagcagccgggagggttcttctccatcgatattgccatcgcatatatt
ttggagattcttcctgctctcgactacctacactcgcgcggcgtggtctataacgacctt
aagccggacaacatcattgttgccgaggaccaggtaaaactgatcgacctaggcgcggtc
tctggcattggagcttttggatatatctacggcacaaagggatttcaagctccggaggta
gccaccgatggcccctcgatcgcgagtgatatctatacgattggccggactcttgccgcc
ctgacggtggatcttccttctgccgatggagtttatttacccggcatcccctcccctgat
gaggaaaaactctttgcccagaacctttccttttaccgcctactgcgccgctgcatgagc
agcgatccggctaagcgttttgcctctatacgtgagctggagactcagctttttgggatt
cttcgggagtatctcgcgctggcggagcaccggcagttccccgcccagcactcgctttat
tcgccccagcgctccacctttggcaccaagcacatggtgtttcgcacagatcagcttatc
gacggcatcgagcgcaacgttcgcatcacctcagaggaggtcaacgccgcgctgccagtc
cccctcttagatcgcaccgaccctggcgcgattctgatttccggggcatcttatgcggag
ccttcgcaaacattgcagacgctacgcgacgctatggctcaggaagaatttgcaaactcc
aaagagattcccctgggcgtagtgcgcacgctgttagatctgggatttattgatgaagca
cgctcttggctggacacattagacgccacgttgagtgatgattggcgccatcagtggtac
tcaggcgtaacatcgctgtttctcgacgattacgtgatggctcagcgccactttaacgag
gtctacaatattcttcctggcgaggccgccccaaagctcgctcgcgctgctgtctgtgag
atgttgctccaggatatgggcatggattcaacaccgttgttatctccagataccgcggtc
tccgccgcggagctcaagggcaacaccattggtatgtggagtgaattgactaaggaccct
gaaactctgcgtttcaaggccctctatctttatgcgttggtatggcggacaaatcccacc
acagtatcctcggcttttgggttggctcggcagttggtagcggagaaccaggtcgatcta
gcggtatctacgctagatcaggttccgcaaaactctacgcacaggcgtatggccgagctc
actgccattttgcacctgatcagcggtgaactcagcgagtcacgcatcaggcgagcagct
cgtaggcttgaaagcattccgaccaatgagccgcgcttcttgcagatcaagatagcgatt
atgaacgccgctctgacatggttacgccaatctcgcctagaggctgcagcagcggacaat
gatctctttgactatcgctttacgcaggtgggcctgcgcaccgggctttatgattctctc
cggcttttagcgcgcagcgcccccaatgcccaccatcggtatacgttggtggacatggcc
aatcaggtccggccgatgacctggttttag

DBGET integrated database retrieval system