KEGG   Comamonas sp. NLF 7-7: FOZ74_14445Help
Entry
FOZ74_14445       CDS       T06146                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cof  Comamonas sp. NLF 7-7
Brite
KEGG Orthology (KO) [BR:cof00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FOZ74_14445 (ahpF)
Enzymes [BR:cof01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FOZ74_14445 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_oxidored GIDA HI0933_like DAO FAD_binding_2 Glutaredoxin FAD_binding_3 AlaDh_PNT_C Thi4 NAD_binding_7 NAD_binding_8 K_oxygenase Thioredoxin_4 FMO-like
Motif
Other DBs
NCBI-ProteinID: QEA14129
UniProt: A0A5B8RWX2
LinkDB All DBs
Position
3017733..3019295
Genome map
AA seq 520 aa AA seqDB search
MFDDQLKTQLAAYLQRVVRPFTLVASLGDDATSTEMREMLQTIAGMRPDMITLREDGQDA
RKPSFTLVREGDEGRLRFAGLPLGHEFTSLVLALLWSGGHPPKEEADLLEQVRQLDGELN
FEVYMSLTCHSCPDVVQALSLMAILNPKIRTTVIEGGAFQKEVSEREIMAVPTVYLNGEM
FSAGHMELAQFVAKLDTGAARRDAEKLSAREAFDMLIVGGGPAGAAAAVYAARKGIRTGL
VAERFGGQVNDTLDIDNYISVPHTEGPQFSSALLQHVREYEVDVMNLQRARALRPAAAPG
GLIEVELENGGVLKARSVVLSTGARWRNMGVPGEDEYRTKGVAYCPSCDGPLYKGKRVAV
IGGGNSGIEAAIDLAGVVAHVTVLEFMPELKADAVLQKKLKSLPNVDVILNAQTTEVLGE
GGKVNALAWKDRISGVQQRLEVEGVFVQIGLLPNTDWLKGTVELSHTGEIMVDARGQTNV
PGVFAAGDCTTVAFKQIVIAAGAGATAALAAFDHLIRAGA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatgaccaactgaaaacccagctcgccgcctatctgcagcgcgtggtgcgtccg
ttcacgctggtggcctcgctgggcgacgacgccacctcgaccgagatgcgcgagatgctg
cagaccattgccggcatgcgccccgacatgatcacgctgcgcgaggacgggcaggacgcg
cgcaagccttcgttcacgctggtgcgcgagggcgacgaggggcggctgcgctttgccgga
ttgccgctggggcatgaattcacctcgctggtgctggccctgctgtggtcgggcggacac
ccgcccaaggaagaggccgatctgctggagcaggtcaggcagctcgacggcgagctgaac
ttcgaggtctacatgagcctcacctgccacagctgtcccgacgtggtgcaggcgctctcg
ctcatggccatcctgaacccgaagatcaggaccacggtgatcgagggcggtgccttccag
aaggaagtgagcgagcgcgagatcatggccgtacccacggtctacctcaatggcgagatg
ttttccgcggggcacatggagctggcgcagttcgtcgccaagctcgataccggcgcggcc
cggcgcgatgccgaaaagctttcggccagggaggcgttcgacatgctcatcgtcggcggc
ggcccggcaggtgcggcagcggcggtgtacgcggcgcgcaagggcatacgcaccggcctg
gtggccgagcgttttggcgggcaggtgaacgacacgctcgatatcgacaactacatttcg
gtgccgcacaccgaggggccgcagttctcctcggcgctgctgcagcacgtgcgcgagtac
gaggtggacgtgatgaacctgcagcgcgccagggcgctgcgacccgcggcggcacccggc
ggtctgatcgaggtcgagctggaaaacggcggcgtgctcaaggcgaggtccgtggtgctg
tccaccggtgcgcgctggcgcaacatgggcgtgcccggcgaagacgaataccgcaccaag
ggcgtggcctactgcccgagctgcgacggcccgctgtacaagggcaagcgcgtggcggtg
atcggtggcggcaattccggcatcgaggcggcgatcgacctggccggggtggtggcgcat
gtgacggtgctggagttcatgcccgagctcaaggccgacgcggtgctgcagaagaagctc
aagagcctgcccaacgtcgacgtgatcctgaacgcccagaccaccgaggtgctgggcgag
ggcggcaaggtcaatgccctggcctggaaggaccgcatcagcggcgtgcagcagcgtctg
gaggtggagggtgttttcgtgcagatcgggctgctgcccaacaccgactggctcaagggc
acggtggagctgtcccataccggcgagatcatggttgatgcgcgcggccagaccaatgtg
ccgggcgtgttcgccgcgggcgactgcaccacggtggcgttcaagcagatcgtgatcgct
gcgggggcgggcgcgacggcggcgctggcggcgtttgaccatctgatccgcgcgggggcc
tga

DBGET integrated database retrieval system