KEGG   Cohnella sp. 18JY8-7: EAV92_20920Help
Entry
EAV92_20920       CDS       T05696                                 

Definition
(GenBank) DNA polymerase domain-containing protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
coh  Cohnella sp. 18JY8-7
Pathway
coh03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:coh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    EAV92_20920
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:coh03400]
    EAV92_20920
Enzymes [BR:coh01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     EAV92_20920
DNA repair and recombination proteins [BR:coh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     EAV92_20920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AYQ74795
UniProt: A0A3G3K2M0
LinkDB All DBs
Position
4520043..4520951
Genome map
AA seq 302 aa AA seqDB search
MEKHLITIEGKELEITHPDRVIWPEAGITKLDYLQYLIQVAPFLLPYTRDRMLMVWRYPD
GILGRRVEERSIHGEAPEWVPRVVYAEKERILLNDAATLVWVANRGGVELHVPFDRFDRK
DYPTELVFDLDPAENMPFEAVREVALKLRDVLNGLSLASIPKTSGATGLQIFVPIEPKYT
FEETRRINTFIARYMQEQMPHRITLERVVEKRGDKLYFDYLQLWRGRTMAAAYSVRAKPK
ATVSTPVTWDEVAAGFHPADFTIAAVPQRLLTVGDLFRQVSSEEFRLQQRIDEVLAFIRK
NG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggagaaacacctgatcacgatagagggcaaagagctcgaaatcacccacccggatcgc
gtgatttggccggaagccggcatcaccaagctggactacttgcagtacttgattcaggtg
gctccgttcctgctgccttacacgagggaccgaatgttgatggtgtggcgttatccggac
gggatcttggggagaagggtcgaggagagatcgatccacggtgaagccccggaatgggtg
ccgcgggtcgtgtatgcggagaaagagagaattttgctaaacgatgcggctacgctcgtc
tgggtggcgaatcggggcggggtcgagctgcatgtgccgtttgaccggttcgaccggaag
gattacccgaccgagttggtgttcgatctggatccggccgaaaatatgcccttcgaagcg
gtgcgcgaggtggcgctgaagctgagggacgtgctgaacgggttgtcgctggccagcata
ccgaaaacgtccggagcgacggggctgcagatattcgtgccgatcgaaccgaaatacacg
ttcgaggagacccgccgcatcaatacgttcatcgcccggtatatgcaggaacaaatgccg
caccggatcacgctcgagcgcgtcgtggagaaacgcggggacaagctgtatttcgactat
ctccagctgtggcggggacggacgatggccgcggcttattcggtaagagcaaaaccgaaa
gccacggtctcgacgccggtcacctgggacgaagtggccgccggtttccatccggcggat
ttcacgatcgccgcggtgccccagcgtctgctgaccgtcggcgacttgttccggcaagta
tcgtccgaggaattccgtctacagcagcggatagacgaggtgctggcattcatccggaaa
aacggttaa

DBGET integrated database retrieval system