KEGG   Cohnella sp. HS21: KCTCHS21_11620Help
Entry
KCTCHS21_11620    CDS       T05979                                 

Definition
(GenBank) hypothetical protein
  KO
K01992  ABC-2 type transport system permease protein
Organism
cohn  Cohnella sp. HS21
Brite
KEGG Orthology (KO) [BR:cohn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cohn02000]
    KCTCHS21_11620
Transporters [BR:cohn02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    KCTCHS21_11620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_2 ABC2_membrane_4 ABC2_membrane_3 DUF2705 ABC2_membrane_5
Motif
Other DBs
NCBI-ProteinID: BBI31763
UniProt: A0A3T1D0X7
LinkDB All DBs
Position
1440667..1441464
Genome map
AA seq 265 aa AA seqDB search
MVNFMNLIKNENMKIFRRVRTWIMLGITIGLPILISIIVLLASGSDAPTSWAIMNIETTI
MFVLITMFTVVIASETVAGEFTWGTIKLLLIRPWSRSAILLSKYLSTLLFALILTVITFI
VTWLINMAVFSSSSDSDVLSSVVGMSNMEYMLKFYLYEFITLIIIVTFGFMMSSAFRSSG
LAIGLSITLLFAGSIITNLLSLTNKAWVEYILFMHLNLTSYIENADGPFHNHPMSLGFSL
SILAGYFVLFNLISWTVFRKRDIAG
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttggttaactttatgaacctcattaagaacgagaatatgaaaatttttcgtcgtgttcgg
acttggattatgttggggatcacaattggattgcctatcctaatttcaatcatagtgctt
ttagctagtggctctgatgcaccaacgagctgggctataatgaatattgaaacaacgata
atgtttgtcttaattacgatgtttaccgttgttatcgcttctgaaacagtggccggtgag
tttacatgggggacaattaaattattattgattcgtccatggagtcgctctgctatattg
ttatcgaaatatttatcaacactactttttgctcttattcttaccgtgattacatttatc
gtaacttggctgattaatatggccgtattcagtagctctagcgattcagatgttttatct
tcagtagtaggcatgtcaaatatggagtacatgcttaagttttacttgtatgaattcata
acccttattatcattgtaacgtttggctttatgatgtcatccgcattccgcagtagtggc
ttggcaattggattgtctattacgctgctgtttgcaggctctatcattacaaacttattg
tcactgacgaataaggcatgggttgaatatatactattcatgcatttgaatctcacaagc
tatatcgagaacgcagatggccctttccataaccacccgatgtcactcggcttttctctc
tccatacttgcgggttatttcgtcttatttaacctcatctcttggacagtatttcggaaa
cgtgatattgcgggttaa

DBGET integrated database retrieval system