KEGG   Cohnella sp. HS21: KCTCHS21_51370Help
Entry
KCTCHS21_51370    CDS       T05979                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase [NADH] FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
cohn  Cohnella sp. HS21
Pathway
cohn00061  Fatty acid biosynthesis
cohn00780  Biotin metabolism
cohn01100  Metabolic pathways
cohn01130  Biosynthesis of antibiotics
cohn01212  Fatty acid metabolism
Module
cohn_M00083  Fatty acid biosynthesis, elongation
cohn_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:cohn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    KCTCHS21_51370 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    KCTCHS21_51370 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    KCTCHS21_51370 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cohn01004]
    KCTCHS21_51370 (fabI)
Enzymes [BR:cohn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     KCTCHS21_51370 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     KCTCHS21_51370 (fabI)
Lipid biosynthesis proteins [BR:cohn01004]
 Fatty acid synthase
  Component type
   KCTCHS21_51370 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF1598
Motif
Other DBs
NCBI-ProteinID: BBI35738
UniProt: A0A3T1DCQ3
LinkDB All DBs
Position
complement(5791874..5792644)
Genome map
AA seq 256 aa AA seqDB search
MNGLLAGKNIVVMGVANERSIAWAIAQSLASQGARLVFTYENERVQERVRKLADTIEGSL
TLQCNVSSDEDIESLAAKLKEEVGVLHGLAHCIAFAKAEELDGLYVDTSRDGFALAHDVS
VYSLTAVAQRLHPLMTEGGSIVTLTYLGAERTLRNYNVMGVAKAALEASVRYLASDLGPQ
DIRVNAISAGPVRTLAAKGIAGFNTILKQVEEKAPLRRNTEASDVGDAALFLMSPWARGI
TGEVIHVDNGYNTVGI
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaatggattgttagctggaaagaacatcgtagtcatgggcgtcgcgaacgagcgcagt
atcgcctgggctatcgcgcaatcgctcgcttcccaaggggctcgactggtgtttacatac
gagaatgaaagagtacaggaacgcgtgcgcaagctagcggatacgattgaaggctcacta
acgctgcaatgcaatgtttcctctgatgaggatattgagtctcttgctgcaaaattgaag
gaagaagtaggcgtattgcacggtcttgcacactgtatcgcttttgcgaaagcagaagag
ctagacggattatatgtagacacttcccgtgatggcttcgcgcttgcacatgatgtaagc
gtatattcccttactgcagtagcgcaaagacttcatccgctgatgacagaaggtggcagt
atcgttaccctgacttatcttggtgcagaacgtactcttcgcaattataacgttatgggc
gtcgccaaggcagcgcttgaagcttccgttcgatatttggcaagtgacttgggtcctcaa
gatattagagtcaacgccatttctgctggtccagttcgtacactggctgccaaaggaata
gccggcttcaatactattcttaagcaagttgaagagaaggctccacttcgccgtaatacg
gaggcatcagatgttggagatgctgccttgttcttaatgagtccttgggctcgtgggatt
actggcgaagtcattcatgttgataatggctataatacagtaggaatttaa

DBGET integrated database retrieval system