KEGG   Corynebacterium pseudotuberculosis CIP 52.97: CpCIP5297_0398Help
Entry
CpCIP5297_0398    CDS       T02054                                 

Gene name
nanH
Definition
(GenBank) Neuraminidase (Sialidase)
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
coi  Corynebacterium pseudotuberculosis CIP 52.97
Pathway
coi00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:coi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CpCIP5297_0398 (nanH)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CpCIP5297_0398 (nanH)
Enzymes [BR:coi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CpCIP5297_0398 (nanH)
Bacterial toxins [BR:coi02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CpCIP5297_0398 (nanH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_3 BNR Golgin_A5
Motif
Other DBs
NCBI-ProteinID: ART29233
LinkDB All DBs
Position
429907..431958
Genome map
AA seq 683 aa AA seqDB search
MTDSHRRGTRKALVTLTAALALTTQGLTAPATLAEEGSTIVPAPIDNNGLFDAAPPAPVA
RGAVGEGKLPEPVTSEFFDSKVIRDVDPAGQRCFRIPAIATAVDGTLLVAFDNRYGPDAQ
SKTWCRDAPYNNKGVNTQEMQTDIEIYRSYDSGESFEKGDFIAKGTEDPRNLSYTDPAIV
VDHETGKIFAFFVRGYDYRLFDANKGINPGPVDAEIARRDVQDTVVIESDDDGKSWKNMR
MISDLTETLRVKTRPGQEVAGYGRFVTSGSGIQLAYGPKAGRLLVPIAVNTKDSGQNRVV
NLAIYSDDHGLSWEIGEGIAGDGVFGGDENKLVELSDGRIMMNSKDNDKDRWTSYSFDQG
EHWSDPVRTVIAPPQHPEMRNKGINVSLIRAYPNAPEGSAAARVLLYSAPIDLRQNGQDG
RSNGWVMASCDDGRSWTHGRQIEAGRFQYSVMTPMADGNIGMVYESGDKERGMTLKFAKF
NMAWLGADCLSNKALGITDLPDPALAKAIEDAKAATAKAEEATANVLKLTKELEEAELEN
EELAQALAEAKSAAQDAIAAAEEANARVKAAEGATTEAEEAAMKAENEAKALAEQLAKVE
AELANSQDQAKALAEAKEAAEIARKAAEEALKLEKEKSGKAGGTDNTENKGFWQELLRIF
PGFAPIFSFLASIWGGMQKLLAF
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgacggattcacaccgccgtggaactcgcaaagcgctggtaacactcacagcagcgctg
gcgctcaccactcaaggccttacggctcctgcgactcttgctgaagagggttcgaccatc
gtacctgcgcccattgataataatgggcttttcgacgctgccccgcccgcgcccgtagcg
cgtggtgcggtgggggagggtaagcttcccgagcctgtaaccagcgaattttttgattcg
aaggttattagagacgtagacccggcaggacagcggtgcttccgtattccggctatcgct
acggcagtagacggaacccttttggtggcttttgataaccgttatggaccggatgcgcag
agcaagacctggtgtagggatgctccttataacaataagggagtcaatactcaggaaatg
cagaccgatattgagatttatcgctcttatgattccggtgaatcttttgagaagggcgac
ttcattgccaaggggaccgaggatccgcggaatctttcatataccgaccctgcgattgtc
gtggaccatgaaacggggaagatatttgcgttctttgtgaggggttatgactaccgctta
tttgatgcaaataaaggaataaatccaggtcctgtcgatgcggaaattgctcgccgtgat
gttcaggatactgttgttatcgaatctgacgatgatggcaagtcttggaaaaatatgcgt
atgatcagcgatctaacagagacgctgcgtgttaaaacgcgaccagggcaagaggttgct
ggttatggaagatttgtaacttctggtagcggtattcagctggcttatggcccgaaggcc
ggtcgactactagtgcctattgccgtgaatactaaagattcggggcagaatagagttgtg
aatctagccatatactctgatgatcacggtttatcctgggaaattggggaaggaattgcc
ggcgacggtgtttttggcggtgatgaaaataagctcgtcgaattgtcagatggacgtatt
atgatgaattccaaagacaatgataaggatcggtggacttcatactcatttgatcagggg
gagcattggtctgacccagtgcgcacggttattgctccgcctcagcatccggagatgcga
aataaaggtatcaatgtttctctgattagggcatatcctaatgccccggaaggtagtgct
gccgcccgagtgctcttgtactccgctccgattgatttaaggcagaacgggcaagacggt
cgtagcaatggttgggtcatggcctcttgcgatgacggtaggtcgtggacgcacgggcgt
cagatcgaagctggccgtttccagtactcggtcatgactcctatggctgacggcaatatt
ggcatggtgtatgaatctggcgataaggaaaggggaatgaccctcaagtttgccaagttc
aacatggcttggctgggagccgattgcttgagcaacaaagccttgggcattaccgatttg
ccggatcctgctttggctaaggctattgaagacgcgaaggctgcgacggctaaggctgag
gaagctacggcgaacgtgctaaagctaactaaggagctagaagaagccgagcttgaaaat
gaagagcttgcacaggctctggctgaggctaagagcgcagcgcaggatgctatcgctgcc
gctgaggaggctaatgctcgggttaaagcagctgagggggctacgactgaggctgaagaa
gctgcaatgaaagcagagaatgaggctaaagcgttagcggagcaattggctaaggttgag
gcggagttagcaaattcccaagatcaggccaaggccttggctgaggctaaagaggctgct
gagatcgctcggaaggcagcggaagaggcccttaagctggaaaaggagaagtctggaaaa
gccggcggtacagataacactgaaaataaaggtttttggcaagaacttttgcggattttt
ccgggatttgcacctattttcagcttcctagcgtcgatatggggcggcatgcagaagctg
ctggcattttaa

DBGET integrated database retrieval system