KEGG   Corynebacterium pseudotuberculosis CIP 52.97: CpCIP5297_1122Help
Entry
CpCIP5297_1122    CDS       T02054                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
coi  Corynebacterium pseudotuberculosis CIP 52.97
Pathway
coi00620  Pyruvate metabolism
coi00680  Methane metabolism
coi01100  Metabolic pathways
coi01120  Microbial metabolism in diverse environments
coi01200  Carbon metabolism
Module
coi_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:coi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CpCIP5297_1122 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    CpCIP5297_1122 (ppc)
Enzymes [BR:coi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CpCIP5297_1122 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AEQ06658
LinkDB All DBs
Position
complement(1228854..1231673)
Genome map
AA seq 939 aa AA seqDB search
MSVKATSAGPLSEQLVEDIRFLGALLGEVIKEQEGIAAFDRVAAARQLAFKISRKESQVE
DLVALLKDISAADAIPIIRAFSHFALLANMVEDLHDELGRLRRQEAGEQDPDSTLGATWK
KLANAGITNEKVSSLLSNFQVAPVLTAHPTETRRRTIFDAQEHMTTLLKKRHAILSSETN
ALTTARLEENTRHIRRWLTLIWQTALIRVARPRIEDEVEVGLRYYELSLLTAIPEINKQV
ADHIQREYGVNSEDALQSLLIKPGSWIGGDHDGNPYVTAGTLHYATTRAAETVLKFYVRE
LHQLEHELSLSDRLTDVSPDLRKLADLGHNDVPSRVDEPYRRAVHGVRGRVLATLASRIG
PETVEGSWYSRHAAYTAPEQLAADLDIIDASLRRTHDELIADDRLLRIRTAVSSFGFHLY
SMDLRQNSESYEDVLTELFERAQVTPHYRKLDESEKISVLIAELSSPRPLIPRDGLPYSE
LTQRELDIIFEAKQAVDAFGTMMIPHSIISMAESASDILEPMVLLKEFGLIKIQEGHLTG
HIDVIPLFETIDDLQNGAKILQDLWQIPLYRSYLEQRGNLQEVMLGYSDSNKDGGYLAAN
WALYAAETDLVNICKQHGIALRLFHGRGGTVGRGGGPSYEAILAQPHGAVQGSVRVTEQG
EIISAKYGSVGAARRNLEALASATLEASLLKIDQVEEQYPEAYEIMGEISRLSQKKYSRL
AHEDPGFIEYFTSSTPLEEIGELNIGSRPSSRKQTKSIDDLRAIPWVLSWSQSRVMLPGW
YGVGSALHEWIEKGCVQTAELSADERLVVLQELNSSWPFFSSVLSNMAQVMSKAEMQLAK
LYSGLVADQEAANRIFSDISAEFELTKKMFLKITGFSGLLDDNPMLARSVRSRYPYLLPL
NTLQLEMLRRYRKGDDDPKVVHGIRLAMNGLATALRNSG
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtaaaagctacgtctgcgggtccactatccgaacaacttgttgaggacatacgc
tttctcggtgctcttttaggggaggtgatcaaggaacaagaaggaatagcagcctttgac
cgggtggcggcagcaagacagctggcttttaagatttctcgtaaggaatcacaggttgaa
gacttagtggcattgctaaaggatatttcagcagcagatgcgataccaatcattagagca
tttagtcatttcgcgctactcgcaaacatggtggaggacttgcacgatgagttgggcaga
cttcggcgacaggaagccggtgaacaagatccagattcaactttaggcgccacatggaaa
aagctggcgaatgctggcataacaaatgaaaaagtttccagtttgctgagtaattttcaa
gtggctccagtgcttactgctcaccctacggaaacccgtagacgcacgatcttcgatgct
caagagcatatgactactctgcttaaaaagcgtcatgcgattcttagctctgagacaaat
gcgctgacaactgcacggcttgaagaaaatactcgtcatattcgtaggtggctgacctta
atatggcaaactgcgcttatccgtgtagcccgtcctcggattgaagatgaggtagaagtt
gggttgcgttattatgagctctctttactcactgcgatccctgagatcaataagcaagtg
gctgatcacatccagagagaatatggtgtgaactccgaagatgctttgcagtcactattg
attaagcccggaagctggatcggtggcgatcatgacggcaacccgtatgtcactgcagga
actctgcactacgcgacaacgcgagccgccgagactgttttaaagttttatgtacgtgaa
ctgcatcaacttgaacacgagttgtcgctatcagacagactcaccgatgttagcccggat
ctgcgtaagcttgcagatctaggccataatgatgttccttcacgggtagacgaaccgtat
cgtcgtgccgtccatggtgtacgtggtcgagtacttgccacactagcttctcgaatcggc
ccagaaacagtagaaggctcatggtattcccgtcatgctgcgtatactgcacctgagcaa
ctcgcagctgatttggacattatcgatgcttctttgcggagaactcacgatgagctcatt
gcagatgatcgtctgctgcgcatacggacagcagtatcgagctttggtttccatctttac
tcgatggatctgcgtcaaaactctgagagttacgaggacgtgcttactgagctctttgag
cgggcccaagtaactccgcactatcgaaaattagatgagagcgaaaaaattagcgttttg
atcgctgagctatcctcgccaaggcctctcattccgcgcgatggcttgccgtacagcgag
ttaacgcagcgggaactcgatattatttttgaggcaaagcaagccgtggatgcctttgga
acaatgatgattccacactctattatttcgatggcagaatctgcgagcgacattctcgag
ccaatggtcctactgaaagaatttggattaatcaagattcaagaaggccatctcacaggg
catattgacgttatacctctttttgaaacaatcgatgacctacaaaatggtgcaaagatt
ctccaagatttgtggcagataccgctgtatcgcagttatttagagcaacgaggcaatctc
caggaagtgatgctcggttattccgattccaataaagatggtggctaccttgccgcaaac
tgggctttatatgcggcagaaactgaccttgtaaacatatgtaagcaacatggtattgct
ctgaggcttttccacgggcgtggtggcaccgtagggcgtggtggcggtccctcttatgag
gcaattctcgctcagccacatggtgcggtgcaaggtagcgtacgcgtcacggagcaaggc
gagattatctcggcaaagtacggttctgtgggagctgctcgccgtaatctggaggctctg
gcctcggccacattggaagcttctttgctcaagatcgatcaagtagaagaacagtatcct
gaggcctatgaaattatgggcgaaatttcgcggttgagtcagaaaaagtattcgcggctt
gctcatgaagatcccggattcattgaatatttcacgtcatcgacgcctttggaagaaata
ggggagctcaatatcggctctcgtccttcctcgagaaaacagactaagagcatcgatgac
ttacgcgcgattccctgggtgcttagttggtcgcagtcacgtgtcatgcttcccggttgg
tatggagtaggcagtgctctacatgaatggatagagaaggggtgcgtgcagacagcggaa
ctatctgcggatgaacgtctcgtggttctgcaagagcttaattcttcctggccattcttt
tcttcggtgttgtctaatatggcgcaggtgatgagtaaggctgagatgcagctcgccaag
ctctactcagggctagtagcagaccaagaagccgcaaataggatattctccgatatctct
gctgaatttgagcttactaagaaaatgttccttaagattaccggtttttcggggcttctc
gacgacaaccctatgctcgcacgatcagttcggtcccgctatccatacttgctacctctt
aatacgctgcaacttgaaatgttacgtcggtatcgcaagggggatgatgaccctaaggta
gtgcatggtattcgtctggctatgaatggcttggccaccgcgctgcgaaattctggttag

DBGET integrated database retrieval system