KEGG   Capnocytophaga sp. oral taxon 323: AM608_01165Help
Entry
AM608_01165       CDS       T04076                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
col  Capnocytophaga sp. oral taxon 323
Pathway
col00020  Citrate cycle (TCA cycle)
col00310  Lysine degradation
col01100  Metabolic pathways
col01110  Biosynthesis of secondary metabolites
col01120  Microbial metabolism in diverse environments
col01130  Biosynthesis of antibiotics
col01200  Carbon metabolism
Module
col_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:col00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AM608_01165
  Amino acid metabolism
   00310 Lysine degradation
    AM608_01165
   00380 Tryptophan metabolism
    AM608_01165
Enzymes [BR:col01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     AM608_01165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ALC98183
UniProt: A0A0M4H3Y8
LinkDB All DBs
Position
258363..261134
Genome map
AA seq 923 aa AA seqDB search
MDKYSFLNAASTAYFGDLYDKYLENPDAVEPSWRAFFQGFDFAQEQYGTPVEEAVPVMVQ
QVVGNENPALSETVKKEFAVLNLINGYRTYGHLFAQINPLRPREPYTPTLAIENYGLTTD
DLNTTFDAAREIGLAPSPLSAIIEALNTTYCKSIGVEYQYIHNPQERDWFTKRLQQNHNK
PQFSKEEKLQILNKLNEATSFENFLHTKYVGQKRFSLEGNDALIAGLDFMVEAAAEQGVK
HVVLGMAHRGRLNVLANVFGKNPKDIFSEFDGKDYEMDDWFDGDVKYHLGITTQRTTRAG
KNVDMNLVPNPSHLEAVNAVVGGITRAKQDRYCQGNFRQALPIIIHGDAAVSGQGIVYET
VQMCGLRGFTNAGTVHIVINNQVGFTANFADSRSSLYCTDIAKMNDSPVLHVNADDAEAV
VRTFLLAIDYRQAFGKDVYINLFGYRKYGHNEGDEPRFTQPLLYKIISKHDNPRNIYAQK
LIEEGLIQQSYVAEIENAYKATLDADLEASRREPLTILKPFMQTEWQGFEIASPKQMLQK
VDTTISKRKLDEIAAVLTELPADKPFISKVKKIVADRKEAYAHNHIDWGMAELLAYGSLL
TEGYDVRITGEDVQRGTFSHRHAVLKTEDTEEEICFLQDLKAKQLATGTFHIYNSLLSEY
GVLGYEYGYAMASPRTLTIWEAQFGDFSNGAQIMIDQYICCGEDKWKVQDGLVMLLPHGY
EGQGAEHSSARIERYLQLCAENNMYVANCTTPANFFHLLRRQMKTTFRKPLVIFTPKSLL
RHPQVISTVEDLAGGQFQEVLDDPLVKAQKVKRVVFCSGRYYYDLYAEREKLGRDDIALV
RIEQLFPLPLTQLKTIIAKYKHATDFIWAQEEPKNMGAYGYMLMNFDLVKWHYVGTPAYA
APASGSHTRDRKRHNEAIAAVFE
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggataagtattcttttttgaatgccgcaagtacggcttattttggcgatttatacgat
aaatatctcgaaaaccccgatgcggtagaacccagttggcgcgctttctttcaaggcttc
gattttgctcaagagcaatacggcactccggtagaagaagcggtacccgtaatggtacaa
caagtggtgggtaacgaaaaccctgcgctttccgaaactgtcaagaaagagtttgccgtg
cttaacctcatcaatgggtatcgcacttacggtcacttattcgcacaaattaatccgcta
cgtcctcgtgagccatatacacctactttggctatcgaaaactacgggcttacgacggat
gacctcaatactaccttcgatgctgcccgtgaaataggcttagctccctcgcctttaagt
gcaattattgaggcgttgaatactacttattgtaagtcgataggggtagaatatcagtat
attcacaatccccaagagcgcgattggttcaccaaacgattacagcaaaatcacaataaa
cctcagttttctaaggaagaaaaactgcaaatccttaacaaacttaatgaagccacttct
tttgagaacttccttcatactaagtatgtaggtcaaaaacgcttttcgcttgaaggcaac
gatgcgctcatcgcaggtctcgactttatggtggaagctgctgccgagcaaggcgtaaaa
cacgtagtactcggtatggcgcaccgtgggcgattaaatgtattagccaatgtgttcggc
aagaatccaaaggatatcttttccgagttcgacggtaaggattacgaaatggacgattgg
ttcgacggtgatgtaaaataccacttgggtatcaccacccaacgcactactcgtgccgga
aaaaacgtagatatgaatttggttcctaacccttcgcacctcgaagctgtaaatgcagtt
gtgggaggtattactcgtgcgaaacaagaccgttattgtcaagggaatttccgacaagcc
ttgcctatcattattcacggtgatgctgctgtgtcagggcagggtatcgtctacgaaaca
gtgcagatgtgtggcttgagaggctttaccaacgcgggtaccgtgcatatagtgattaac
aaccaagtagggtttactgctaattttgccgactcgcgttcgtcgttgtactgtaccgat
attgcaaagatgaacgattcgcctgtgcttcacgtaaatgccgacgatgccgaagccgta
gtgcgcacttttctcttggcaatcgattaccgccaagcctttggcaaagacgtgtatatc
aatctctttggctatcgtaaatacggtcataatgaaggcgatgaaccgcgttttacacaa
cctcttttgtacaaaattataagtaagcacgacaatccccgcaatatttacgcacagaag
ctaatcgaagaagggctcatacagcaaagttatgttgccgagatagagaatgcttataaa
gctactcttgatgccgacctcgaagcatctcgtcgcgaaccacttacgatattaaagcct
tttatgcaaaccgaatggcaaggctttgaaatagcgtcgccaaaacaaatgttacaaaag
gtagatacgactattagcaaacgaaaactcgacgaaatagctgctgtacttactgaattg
cctgccgataaaccttttatcagtaaggtgaagaagattgtagccgaccgtaaagaagcg
tatgcacacaaccatatcgattggggaatggcagagctcttggcgtatggttcactcctt
actgagggctacgatgtacgtattactggggaagatgtgcaacgcggtacgttctcacac
cgtcacgctgtgctcaaaacagaagataccgaagaagaaatatgcttcttgcaagacctc
aaagccaaacaattggcaacaggtactttccatatctacaattcgttgttatccgaatat
ggagtcttgggctatgagtacggctatgcaatggcaagtccgcgcacgctcaccatatgg
gaagcacagttcggcgacttctccaatggcgcacaaataatgattgaccagtatatctgt
tgtggtgaagacaaatggaaagtgcaagacggattggtaatgttactccctcacggttat
gaaggacaaggagctgagcactcttcagcacgcatagaacgctatttgcaactctgtgct
gagaacaatatgtatgtagccaattgtactacccccgctaactttttccacctattacgt
cgccaaatgaagactaccttccgtaagccgttggtaatattcactcctaaaagcttattg
cgtcacccccaagtgatttcaactgtggaagacttagctggtggacagttccaagaggtg
ttagacgaccctctcgttaaagctcaaaaagtaaaacgcgtagtattttgctctggtcgc
tattactacgacctctatgccgaacgcgaaaaacttggcagagacgatatagccttagtg
cgcatcgagcagctgttcccgctaccgctaacacagctcaaaaccattatagcgaagtac
aaacacgccaccgactttatttgggcgcaagaagaacctaaaaatatgggcgcttatggt
tatatgttaatgaatttcgatttggtaaaatggcattatgtaggtactcccgcctatgca
gcccctgcttctggtagccatactcgtgaccgcaaacgccacaacgaagctatcgcagct
gtatttgaataa

DBGET integrated database retrieval system