KEGG   Capnocytophaga sp. oral taxon 323: AM608_10290Help
Entry
AM608_10290       CDS       T04076                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
col  Capnocytophaga sp. oral taxon 323
Pathway
col00240  Pyrimidine metabolism
col01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:col00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AM608_10290
Enzymes [BR:col01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AM608_10290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK UvrB_inter DUF777
Motif
Other DBs
NCBI-ProteinID: ALC97993
UniProt: A0A0M4GP20
LinkDB All DBs
Position
complement(2348635..2349228)
Genome map
AA seq 197 aa AA seqDB search
MFLENTVNNNEKAGWIEVICGSMFSGKTEELIRRLRRAQFAKQKVEIFKPSFDTRYDDTN
IVSHNANEIPSTPVEAAASIMLLADGCDVVGIDEAQFFDDEIVHVCNELANRGVRVIVAG
LDMDYKGKPFGPMPFLMATAEYVTKVHAVCTRTGNLANYSFRKVSNDQQRLLGEADSYEP
LSRAAFYKAMNAKKTKE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtttttagagaatactgtaaataacaacgaaaaagcgggctggatagaagtaatatgc
gggtcgatgttctcaggcaaaaccgaagaactgattcgccgattacgtcgtgcccaattt
gcaaaacagaaggtagagatatttaaacccagtttcgacacgcgttatgatgataccaat
atcgtatcgcacaacgccaatgaaattccttctacacccgtagaagccgccgccagcatt
atgcttcttgccgatggttgcgatgtggtgggtatagacgaagcacagtttttcgacgac
gagatagtacacgtgtgcaatgagctcgccaatcgcggggtacgcgtaatcgtagcagga
ctcgatatggactataaaggaaagcctttcggacctatgcccttcttaatggctactgcc
gagtatgttactaaggtacacgctgtttgtacacgtactggcaacctcgccaattatagt
tttcgcaaagtttctaacgaccagcaacgcttgttaggagaagccgatagctatgagcct
ctcagtcgcgctgccttctataaagcaatgaatgctaagaaaacaaaagaataa

DBGET integrated database retrieval system