KEGG   Colwellia sp. Arc7-D: DBO93_00890Help
Entry
DBO93_00890       CDS       T05422                                 

Definition
(GenBank) shikimate kinase AroK
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
cola  Colwellia sp. Arc7-D
Pathway
cola00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cola01100  Metabolic pathways
cola01110  Biosynthesis of secondary metabolites
cola01130  Biosynthesis of antibiotics
cola01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cola00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DBO93_00890
Enzymes [BR:cola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     DBO93_00890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 AAA_33 Cytidylate_kin AAA_24 AAA_16 AAA_22 dNK APS_kinase AAA ABC_tran AAA_25 TsaE Ploopntkinase3 ATP_bind_2 AAA_17 AAA_5 AAA_7 AAA_29 Guanylate_kin His_biosynth RNA_helicase Zeta_toxin AAA_PrkA
Motif
Other DBs
NCBI-ProteinID: AWB56264
UniProt: A0A2S0UWD4
LinkDB All DBs
Position
208232..208750
Genome map
AA seq 172 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRELADKLHLEFFDSDQEIERRTGADIAWVFDLEGEEGFR
LREESVIEDLSEKQGIVLATGGGSVISAQVRNRLSARGIVVYLETTIDKQVARTQRDRRR
PLLQTDEEPRTVLENLAVERNPLYEEIADVIVQTDDQSAKVVASKIVERLDF
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaacgtaatattttccttgtaggcccaatgggcgcaggcaaaagcaccatt
ggtagagaattagcagataagctacatttagagttttttgattccgatcaagaaattgag
cgtcgtactggtgctgatatcgcatgggtttttgatcttgaaggtgaagaaggctttcga
ttgagagaagaatcagtcattgaagacttaagtgaaaaacagggaattgttttagctact
ggtggtggctctgtgattagcgctcaagtacgcaatcgcttatcagcgcgcggtattgtt
gtctatcttgaaactactatagataaacaagttgctcgcacgcaaagagaccgacgccgt
ccgctactccaaactgatgaagaacctagaactgtacttgaaaacctagctgttgagcgt
aatccgttatatgaagaaattgccgatgttatcgtgcaaacggatgatcaaagtgcaaag
gttgtagctagtaaaatagtagagcgattagatttctaa

DBGET integrated database retrieval system