KEGG   Colwellia sp. Arc7-D: DBO93_02865Help
Entry
DBO93_02865       CDS       T05422                                 

Gene name
panP
Definition
(GenBank) putative pyridoxal-dependent aspartate 1-decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cola  Colwellia sp. Arc7-D
Pathway
cola00250  Alanine, aspartate and glutamate metabolism
cola00410  beta-Alanine metabolism
cola00430  Taurine and hypotaurine metabolism
cola00650  Butanoate metabolism
cola01100  Metabolic pathways
cola01110  Biosynthesis of secondary metabolites
cola01120  Microbial metabolism in diverse environments
cola02024  Quorum sensing
Module
cola_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DBO93_02865 (panP)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DBO93_02865 (panP)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DBO93_02865 (panP)
   00430 Taurine and hypotaurine metabolism
    DBO93_02865 (panP)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DBO93_02865 (panP)
Enzymes [BR:cola01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     DBO93_02865 (panP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS
Motif
Other DBs
NCBI-ProteinID: AWB56607
UniProt: A0A2S0UXC7
LinkDB All DBs
Position
658842..660470
Genome map
AA seq 542 aa AA seqDB search
MTVSKRAAKVSEESLHRIFTIPVAPDSTLGRIENDISQNLAGFLGEHIAATEQALSEIEK
DFADPKIPEEPAFVSDHMQHLLDKLVSQSVHTSSPNFIGHMTSALPYFILPLSKLMVGLN
QNLVKIETSKAFTPMERQVLGMMHRLVYQDDEPFYQQWMHSANHSLGAFCSGGTVANLTA
LWVARNNLLKPNGNFKGVAREGLFNALKHYQYDGLAILVSARGHYSLKKSADILGIGQDS
VIAIPTDENNKIDCKLLEAKCQQLASQNIRVLSIVGVAGTTETGNIDPLDKMANIAQRYQ
AHFHVDAAWGGATLLSNKYRPLLKGIELADSVTIDAHKQMYVPMGAGLVVFKNPASVAAI
EHHAEYILRKGSKDLGSHTLEGSRPGMAMLVYSALHVISRPGYELLINNSIEKANYFAEL
ITQHADFELVTKPELCLLTYRYNPACVQKVLANADDLKQEEMNLLLDKLTKFIQKRQREN
GKSFVSRTRIEVQKYQGRKTLVFRVVLANPLTSKTILQDVLAEQVLLAQESENFLPQLLS
LK
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcagtaaacgcgcggcaaaagtatctgaagagtctttacatcgtatttttacc
attccagttgcacccgattctacattgggacgcattgagaatgacatatctcagaactta
gctggttttctgggtgagcacattgcggccactgaacaagctttaagcgaaattgaaaaa
gattttgcggatcctaagatccctgaagagcctgcttttgtttcagaccatatgcagcac
ttacttgataagttagtgtctcagtccgttcatacttcaagtccaaattttatcggtcat
atgacctctgctttaccgtactttattttaccgctttcgaaattgatggtcggcttaaat
caaaatttggtaaaaatagaaacctctaaagcatttaccccaatggaacgacaagttctg
ggtatgatgcatcgtttggtttaccaagatgacgaacccttttaccagcaatggatgcac
agtgcgaatcattctttgggtgcgttttgttcaggtgggactgtagcaaatttaacggca
ctttgggtggcgcgtaataacttgcttaaacctaatgggaactttaaaggtgtagcacga
gagggcttgtttaacgcacttaagcactatcaatacgatggcttagctattttagtttcc
gcacgtggtcactattctctgaaaaaatcagcagatattttaggcataggccaagacagt
gttattgctattccaaccgatgaaaataataaaattgactgcaaactgcttgaagctaaa
tgtcagcagttagcaagccagaatattcgggtactcagtatagtgggtgttgctggcacc
actgaaactggcaatatagacccgcttgataaaatggctaatattgctcaacgctaccaa
gcacactttcatgttgatgcagcgtggggtggcgcgactcttttatctaataagtatcgt
ccactactaaaaggtatagagttagccgactcagtgactattgatgcacataaacaaatg
tatgtgccaatgggagctggcttagtggtgtttaaaaaccctgcttctgttgctgcaatt
gaacatcatgccgaatatattttgcgcaaaggatcaaaagatttaggtagccatacgctt
gaaggttcaagacctggtatggcaatgttggtgtactctgcattgcacgttattagtcga
cctggctatgagttactgattaataatagtattgaaaaagcgaattattttgccgagttg
atcacccaacatgccgattttgaattggtcactaaaccagaattatgcttattaacgtat
cgctataaccctgcttgtgtacaaaaagtattggctaatgctgatgacctaaaacaagaa
gaaatgaacctattgcttgataagttgacaaaattcattcaaaagcgtcaacgtgaaaat
ggcaagtcttttgtttctagaacccgtatcgaagtacaaaaataccaaggtcgtaaaacg
ttagtttttagagtggtattagccaacccgttaacgtcaaaaactattctacaagatgtg
ttagcagagcaagtgctattagcacaagagagtgaaaactttctccctcaacttttatcg
ctgaaataa

DBGET integrated database retrieval system