KEGG   Colwellia sp. Arc7-D: DBO93_12445Help
Entry
DBO93_12445       CDS       T05422                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
cola  Colwellia sp. Arc7-D
Brite
KEGG Orthology (KO) [BR:cola00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cola01002]
    DBO93_12445
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cola04147]
    DBO93_12445
   04090 CD molecules [BR:cola04090]
    DBO93_12445
Enzymes [BR:cola01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     DBO93_12445
Peptidases [BR:cola01002]
 Metallo Peptidases
  Family M2
   DBO93_12445
Exosome [BR:cola04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DBO93_12445
CD molecules [BR:cola04090]
 Proteins
  DBO93_12445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: AWB58295
UniProt: A0A2S0V278
LinkDB All DBs
Position
2849806..2851650
Genome map
AA seq 614 aa AA seqDB search
MKPTFKLTTAAIIVATSLSACNGEKVVKIDTKATSQPSKTLTMKDADKFLAATEKELIQL
NTVGARAAWINANFITEDTSALAAAADQKSTEAGVRFAMQAANFDAVEVNTDQRRKLNIL
KQSLVMPAPQDAKKSADLSKIGAELNSMYGKGKYKAESGETLSLGQMTATMATSRNYDEL
LEMWQGWRTISPDMKPLYIRQAELGNEGAQGLGYEDLGAMWRSNYDMSANEFATELDRLW
GQVKPLYDDLHCYVRTELGKTYGEDKVPQDQPIPAHLLGNMWAQSWGNIYDLVAPENADP
GYDLTKQLAANNYDEIKMVKGAESFFTSLGFEALPETFWQRSLFTKPADRDVVCHASAWD
LDSKDDIRIKMCIQKTGEDFSVIHHELGHNFYQRAYQNQPVYYQNSANDGFHEAIGDTIA
LSVTPKYLKEIGLINTIPDESKDIGLLMKMALDKVAFIPFGLMVDQWRWKVYSGEVTPEN
YNTAWWELREKYQGVRAPVERETNAFDPGAKYHVPGGVPYSRYFLAHIQQFEFHRALCEI
SGNTDPIHRCSIYNNKDAGAALNTVLEMGSSQPWQQAYKVLTGSEQMDATAILDYFAPLH
TWLKDKNQGKQCGF
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaacgtttaaattaaccacagcagcgattatagttgccactagcttaagtgcc
tgtaatggcgagaaagtagtaaaaattgacactaaagccactagccaacctagcaaaacg
ttaaccatgaaagatgcggataaatttttggccgccactgagaaggaattaattcaactt
aataccgtgggtgctcgtgccgcttggatcaatgctaactttattactgaagatacttct
gcgctagccgccgctgccgatcaaaaatcgactgaagctggtgttcgttttgccatgcaa
gcggctaactttgatgctgttgaagtcaatacagatcaacgccgaaagctgaatatatta
aaacaaagtttagtgatgccagcccctcaagatgctaaaaaatcagcagacttatcaaaa
attggtgctgaactaaatagcatgtatggcaaaggaaaatataaggctgaatcaggtgaa
acgttaagcttaggccaaatgacggcaacaatggcaacgtcacgtaactacgatgagtta
ttagaaatgtggcaaggctggcgaacaattagtcctgacatgaaacctctctatattcga
caagcagaattgggtaacgaaggtgcacaaggtttaggctatgaagacttaggcgcaatg
tggcgttctaattacgatatgtcagcaaatgaatttgccacagaacttgaccgcttatgg
ggacaagttaaacctttatatgatgatctgcattgttatgtgcgcacagagctaggcaaa
acttatggtgaagataaagtaccacaagatcaacctattcctgcgcatttactgggtaat
atgtgggctcaatcatggggtaatatttacgacttagttgcgccagaaaatgccgatcct
ggctatgatcttaccaaacaactcgccgcaaataattacgacgaaattaaaatggtaaaa
ggagctgaaagcttttttacatcgcttggctttgaagccttaccagaaacattttggcag
cgctcattatttactaaacctgccgacagagatgttgtttgtcatgcatcagcatgggat
ttagattctaaagacgatattcgcattaaaatgtgtatccaaaaaacgggtgaagatttc
tcagttatacatcacgagctaggacataacttttatcaacgcgcataccaaaaccaacca
gtttattatcaaaacagtgctaacgacggttttcatgaagccattggtgacactatagcc
ctttcggtaacacctaagtacttaaaagaaattggcttaattaacaccattccagatgag
tctaaagatattggtttactcatgaaaatggcattggataaagtcgcctttattcctttt
ggtttaatggtcgatcaatggcgttggaaagtttactctggtgaagttactcctgaaaat
tacaatacagcttggtgggagttacgtgaaaaataccaaggtgttagagcaccagttgag
cgtgaaacaaatgcctttgatcccggtgctaaatatcatgttcctggtggcgtgccttat
tcacgctacttcttagcccatatacagcagtttgaatttcaccgtgccttgtgtgaaata
tcaggtaataccgaccctatccatcgttgttctatctataacaacaaagatgccggtgct
gctctaaatactgtacttgaaatgggttcaagccaaccatggcagcaagcctataaagtg
ctaacgggtagtgagcaaatggatgcaactgccattttggattacttcgcacctttacac
acttggttgaaagataaaaaccaaggcaagcaatgtggcttttaa

DBGET integrated database retrieval system